BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0300 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 27 0.17 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.17 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.17 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 1.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.6 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 23 1.6 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 26.6 bits (56), Expect = 0.17 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 356 EIDTLRNIFTDRVETSQS 409 E+D++RNIF+D +E SQ+ Sbjct: 11 ELDSIRNIFSDVLEESQT 28 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 26.6 bits (56), Expect = 0.17 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 356 EIDTLRNIFTDRVETSQS 409 E+D++RNIF+D +E SQ+ Sbjct: 71 ELDSIRNIFSDVLEESQT 88 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 26.6 bits (56), Expect = 0.17 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 356 EIDTLRNIFTDRVETSQS 409 E+D++RNIF+D +E SQ+ Sbjct: 71 ELDSIRNIFSDVLEESQT 88 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 161 LENIPFIKLESGHINKPQLLVTFKLG 84 L+NI LESG K Q L T K+G Sbjct: 545 LKNIDLTVLESGAFCKMQPLRTLKIG 570 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -1 Query: 595 NKGLNSHNPTQRHFCKFCPITVNLDQSLKLKM 500 N + SH+ R+ C+ C SLK+ + Sbjct: 275 NSHMKSHSNVYRYSCRDCSYATKYCHSLKIHL 306 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -1 Query: 595 NKGLNSHNPTQRHFCKFCPITVNLDQSLKLKM 500 N + SH+ R+ C+ C SLK+ + Sbjct: 33 NSHMKSHSNVYRYSCRDCSYATKYCHSLKIHL 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,728 Number of Sequences: 336 Number of extensions: 2858 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -