BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0300 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81510-2|CAB04162.1| 56|Caenorhabditis elegans Hypothetical pr... 29 3.7 Z98853-4|CAB57905.1| 301|Caenorhabditis elegans Hypothetical pr... 28 6.5 >Z81510-2|CAB04162.1| 56|Caenorhabditis elegans Hypothetical protein F21D9.3 protein. Length = 56 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 347 EKSEIDTLRNIFTDRVETSQSRCCCFR 427 +K R IF D T S CCCFR Sbjct: 26 KKGATSAKRKIFNDAPGTWSSSCCCFR 52 >Z98853-4|CAB57905.1| 301|Caenorhabditis elegans Hypothetical protein R08A2.4 protein. Length = 301 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -3 Query: 500 VYISEYYLINL*NDSSLRMLIRQNL*SNNICSVKFQLDQ*KYFVVYRSQISQHII 336 V + ++ L + N SS I + + CS+ Q + +YF++Y ISQ I+ Sbjct: 191 VKLKQWRLASNLNISSFAASISVSYFIQSNCSIFIQSSRMQYFIIYNRCISQEIV 245 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,411,481 Number of Sequences: 27780 Number of extensions: 255609 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -