BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0300 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 1.4 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 5.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 137 LESGHINKPQLLVTFKLGP 81 L +G +N PQLL+ +GP Sbjct: 319 LSAGSVNTPQLLMLSGIGP 337 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 595 NKGLNSHNPTQRHFCKFCPITVNLDQSLKLKM 500 N L SH+ ++ C C SLKL + Sbjct: 33 NSHLKSHSNVYQYRCANCTYATKYCHSLKLHL 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,564 Number of Sequences: 438 Number of extensions: 3252 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -