BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0297 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 7.3 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 9.7 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 23.0 bits (47), Expect = 7.3 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 400 TIILKYLLVPNHNTIICSCCL*IHM--YLVHN 311 T +L L VPNH T++ + H ++++N Sbjct: 21 TXVLDPLRVPNHTTVVAPSAVSPHQSSFMINN 52 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 22.6 bits (46), Expect = 9.7 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 477 HNISGIYFLFSPISMIS 427 H + G+Y F P+++I+ Sbjct: 10 HPLVGVYLFFKPVALIT 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,781 Number of Sequences: 2352 Number of extensions: 9394 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -