BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0294 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/41 (21%), Positives = 25/41 (60%) Frame = -3 Query: 397 NNTVSNTYMKHTTIVSNIEIILKVILIVNVSYTYSLQNTKE 275 ++T+S TY+ ++S + +I I ++ +Y+ + ++ +E Sbjct: 11 SSTISITYLLAYLVISFLIVINMYIAVILENYSQATEDVQE 51 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/41 (21%), Positives = 25/41 (60%) Frame = -3 Query: 397 NNTVSNTYMKHTTIVSNIEIILKVILIVNVSYTYSLQNTKE 275 ++T+S TY+ ++S + +I I ++ +Y+ + ++ +E Sbjct: 11 SSTISITYLLAYLVISFLIVINMYIAVILENYSQATEDVQE 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,979 Number of Sequences: 2352 Number of extensions: 11022 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -