BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0294 (558 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X96395-1|CAA65259.2| 1545|Homo sapiens canalicular multidrug res... 29 8.4 U63970-1|AAB39892.1| 1545|Homo sapiens canalicular multispecific... 29 8.4 U49248-1|AAB09422.1| 1545|Homo sapiens canalicular multispecific... 29 8.4 AL392107-3|CAI11010.1| 1545|Homo sapiens ATP-binding cassette, s... 29 8.4 AL133353-8|CAI14503.1| 293|Homo sapiens ATP-binding cassette, s... 29 8.4 AL133353-7|CAI14502.1| 1545|Homo sapiens ATP-binding cassette, s... 29 8.4 AJ132244-1|CAB45309.1| 1545|Homo sapiens multidrug resistance pr... 29 8.4 >X96395-1|CAA65259.2| 1545|Homo sapiens canalicular multidrug resistance protein protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >U63970-1|AAB39892.1| 1545|Homo sapiens canalicular multispecific organic anion transporter protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >U49248-1|AAB09422.1| 1545|Homo sapiens canalicular multispecific organic anion transporter protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >AL392107-3|CAI11010.1| 1545|Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 2 protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >AL133353-8|CAI14503.1| 293|Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 2 protein. Length = 293 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >AL133353-7|CAI14502.1| 1545|Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 2 protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 >AJ132244-1|CAB45309.1| 1545|Homo sapiens multidrug resistance protein 2 (MRP2) protein. Length = 1545 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 343 QYLRQW*CVSYRCWILYYFYLLFISMNRFNY 435 QY RQW CV W L F++L I F + Sbjct: 118 QYSRQW-CVQKNSWFLSLFWILSILCGTFQF 147 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,384,251 Number of Sequences: 237096 Number of extensions: 1523915 Number of successful extensions: 1762 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1762 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -