BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0292 (336 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 38 0.002 SB_39574| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_39106| Best HMM Match : Prion (HMM E-Value=1.2) 26 8.7 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 38.3 bits (85), Expect = 0.002 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +1 Query: 247 FGITGGAHRLWSHNGYKVKLPLEILL 324 +G+T GAHRLW+H +K K PL +++ Sbjct: 18 YGVTIGAHRLWAHRTFKAKWPLRLVI 43 >SB_39574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 146 IAKTYHVHHYNFVFDGRGLGCNEFFII 66 I +H YN +DG G G N F+I Sbjct: 436 IVLMFHTFVYNKTYDGFGEGHNRLFVI 462 >SB_39106| Best HMM Match : Prion (HMM E-Value=1.2) Length = 523 Score = 25.8 bits (54), Expect = 8.7 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 12 PNSVDKT-NETEYLKDNHVDYEKLIAPQASPIKHKIVVMNVIRFSYL 149 P+ +DK NE E N+V+Y + +AP I + V R SYL Sbjct: 258 PHILDKAANEVE----NNVEYSQPVAPNTQHIDEQDSVTKTRRVSYL 300 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,219,199 Number of Sequences: 59808 Number of extensions: 173379 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 473307974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -