BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0291 (607 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1507 - 37838645-37839311,37839393-37839499,37839588-378396... 29 3.8 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 27 8.7 >01_06_1507 - 37838645-37839311,37839393-37839499,37839588-37839663, 37839747-37839869,37840051-37840208,37840311-37840385, 37840466-37840506,37840594-37840670,37840755-37840883, 37840990-37841060,37841237-37841332,37841489-37841584, 37841681-37841953,37842871-37842957,37843101-37843178, 37843350-37843514,37843622-37843768,37843921-37843983, 37844082-37844201,37844352-37844543,37844672-37844748, 37845094-37845196,37845684-37845887 Length = 1074 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 450 HKLIFFILRFVFYRPGQDVKLFIYCG 527 H++ F ILR V Y PGQ K F+ CG Sbjct: 244 HEVHFSILREVVYTPGQQDKCFL-CG 268 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 140 CTLTQSNDGFAYKNFIDNLICTSKRSCVQTYYFV 241 C T++ + F YKN++DN++ + V + V Sbjct: 29 CFSTETMEQFEYKNYLDNIVLQLREQFVDSSLMV 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,608,285 Number of Sequences: 37544 Number of extensions: 209270 Number of successful extensions: 378 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -