BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0291 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 2.9 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.9 SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 93 FTQSQLYHVNTLLYFQCGCCMTVCASCRI 7 F ++ L + L+YF C C M V +C I Sbjct: 175 FQKTNLKPASLLIYFSCSCSMLVLTTCYI 203 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 125 LQLSNCTLTQSNDGFAYKNFIDNLICTSKRS 217 L+++ LT D ++YKN+I NL+ + S Sbjct: 106 LEMNGILLTLQTDSYSYKNYIKNLLSHPQES 136 >SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1169 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 140 CTLTQSNDGFAYKNFIDNLICTSKRSC 220 C + N F KN +D L+CT+ R C Sbjct: 895 CPVGTYNPSFGAKNVLDCLMCTAGRYC 921 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,545,265 Number of Sequences: 59808 Number of extensions: 277231 Number of successful extensions: 516 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -