BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0291 (607 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 3.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.8 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 140 CTLTQSNDGFAYKNFIDNLICTSKRSCVQTY 232 CT +D A KNF D+ +C + +Q Y Sbjct: 210 CTGPTQSDCLACKNFYDDGVCKQECPPMQIY 240 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 483 FYR-PGQDVKLFIYCGIMLYNNSLG 554 FYR G D+ L YC +Y N G Sbjct: 94 FYRMEGSDLTLRHYCSEAIYRNGYG 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,898 Number of Sequences: 2352 Number of extensions: 9160 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -