BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0289 (382 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 2.1 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 2.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.7 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 4.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 4.9 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 6.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 6.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 8.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 20 8.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 8.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 20 8.5 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 22.2 bits (45), Expect = 2.1 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +3 Query: 45 PWWIGISCARAYSKPLRQSSLTARIRIYPPRTPSNP*TSLPI 170 PW+ G + R K + + A I PP P++ LP+ Sbjct: 152 PWFKGWTVERKEGKVEGKCLIEALDAILPPTRPTDKALRLPL 193 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 22.2 bits (45), Expect = 2.1 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +3 Query: 45 PWWIGISCARAYSKPLRQSSLTARIRIYPPRTPSNP*TSLPI 170 PW+ G + R K + + A I PP P++ LP+ Sbjct: 209 PWFKGWTVERKEGKVEGKCLIEALDAILPPTRPTDKALRLPL 250 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 89 APPILPYGPDSNLSPEDTVESINIITDHI 175 APP+LP N D +E + TD I Sbjct: 357 APPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 89 APPILPYGPDSNLSPEDTVESINIITDHI 175 APP+LP N D +E + TD I Sbjct: 357 APPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 89 APPILPYGPDSNLSPEDTVESINIITDHI 175 APP+LP N D +E + TD I Sbjct: 357 APPVLPENHLKNAKYLDVIERNSGATDKI 385 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 3.7 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 121 ESIPRGHR-RIHKHHYRSHLFRDH 189 E++ R H + H HH +S +DH Sbjct: 136 ETLQRHHHLQNHHHHLQSTAVQDH 159 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 271 LGTRQSGPTIVFPRIQTGFGCVVYN 345 L +G T+V+ GF ++YN Sbjct: 191 LSCEVNGSTLVYIGDNEGFALIIYN 215 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 202 RSRCGGQLPP 231 RS GGQLPP Sbjct: 402 RSPAGGQLPP 411 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 20.6 bits (41), Expect = 6.5 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +3 Query: 45 PWWIGISCARAYSKPLRQSSLTARIRIYPPRTPSNP*TSLPI 170 PW+ G R ++ + A I PP P++ LP+ Sbjct: 209 PWYKGWKVERKDGNADGKTLIEALDAILPPSRPTDKALRLPL 250 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 6.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 207 SMWRTASTASDYPPELRNLLRVRNAAIRAYDRLP 308 S+ RT T S PP + + A+R ++P Sbjct: 726 SLERTQPTMSQMPPTAQPRMERLAEAVRTASQIP 759 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 156 TSLPITSLPRS 188 T++PITSLP S Sbjct: 852 TTVPITSLPAS 862 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 6.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 239 LSSGT*ESLKS*ERGNPGLRSSSHAFKP 322 LSSG+ S R N +S +FKP Sbjct: 609 LSSGSNNQTSSASRENTSNTTSMESFKP 636 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.2 bits (40), Expect = 8.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 21 TTQSLLRGPWWIGISCARAYSKPLRQSSLTARIRIYPPRTPSNP 152 TT + + + +G+S + Y L +++ ARI RT P Sbjct: 576 TTVTCILQRFGVGVSFSAVYGALLTKTNRIARIFDSASRTAVRP 619 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 20.2 bits (40), Expect = 8.5 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = -3 Query: 125 DSNPGRKGGLAERLRVGTCTAYSNPPWSS*Q*LGCEG 15 D P ++E++ G C P WS C G Sbjct: 88 DGVPSSLNVISEKIGNGGCLLQPYPDWSWANYKDCSG 124 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 228 WKLSSTSTSFEDLMI 184 W L ST+ S ED+ + Sbjct: 216 WSLDSTAASDEDISL 230 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.2 bits (40), Expect = 8.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 21 TTQSLLRGPWWIGISCARAYSKPLRQSSLTARIRIYPPRTPSNP 152 TT + + + +G+S + Y L +++ ARI RT P Sbjct: 666 TTVTCILQRFGVGVSFSAVYGALLTKTNRIARIFDSASRTAVRP 709 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,038 Number of Sequences: 438 Number of extensions: 2831 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -