BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0281 (452 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.39 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 4.7 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 25.0 bits (52), Expect = 0.39 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 117 GRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSP 254 G +L GVV K KM R + + H + N+FE + +H+SP Sbjct: 590 GMVLAGVVGK-KMPRYCL----FGHNVTLANKFESLSEPLRIHVSP 630 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 113 PRAHPHRRRSEDEDAENYRDPPRL 184 P H H +++ +YR PP L Sbjct: 349 PPHHHHHHQTQSLQHLHYRQPPTL 372 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,069 Number of Sequences: 438 Number of extensions: 2135 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -