BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0281 (452 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribo... 183 6e-47 At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) 177 2e-45 At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) 174 2e-44 At1g49400.1 68414.m05537 ribosomal protein S17 family protein si... 39 0.002 At3g18880.1 68416.m02398 ribosomal protein S17 family protein si... 37 0.007 At1g79850.1 68414.m09328 30S ribosomal protein S17, chloroplast ... 31 0.28 At4g26980.1 68417.m03882 expressed protein 27 4.5 At4g12390.1 68417.m01958 invertase/pectin methylesterase inhibit... 27 4.5 At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing ... 27 5.9 At2g24070.1 68415.m02875 expressed protein contains Pfam domain,... 27 5.9 At1g17210.1 68414.m02097 expressed protein distantly related to ... 27 5.9 At5g55920.1 68418.m06975 nucleolar protein, putative similar to ... 27 7.8 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 27 7.8 >At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribosomal protein S11, Arabidopsis thaliana,PIR2:C35542 Length = 159 Score = 183 bits (445), Expect = 6e-47 Identities = 83/111 (74%), Positives = 95/111 (85%) Frame = +3 Query: 12 RHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLH 191 R KN+GLGFKTPREAIEGTYID+KCPFTG VSIRGRIL+G KMQRTI++RRDYLH Sbjct: 34 RFWKNIGLGFKTPREAIEGTYIDQKCPFTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLH 93 Query: 192 YLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 344 ++ KY R+EKRH N+ H+SPCFR V+ GD VTIG+CRPLSKTVRFNVLKV Sbjct: 94 FVKKYRRYEKRHSNIPAHVSPCFR-VKEGDRVTIGQCRPLSKTVRFNVLKV 143 >At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) Length = 160 Score = 177 bits (432), Expect = 2e-45 Identities = 79/111 (71%), Positives = 92/111 (82%) Frame = +3 Query: 12 RHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLH 191 R KN+GLGFKTPREAI+G Y+DKKCPFTG VSIRGRIL G KMQRTI++RRDYLH Sbjct: 34 RFWKNIGLGFKTPREAIDGAYVDKKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLH 93 Query: 192 YLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 344 ++ KY R+EKRH N+ H+SPCFR V+ GD + IG+CRPLSKTVRFNVLKV Sbjct: 94 FVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHIIIGQCRPLSKTVRFNVLKV 143 >At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) Length = 159 Score = 174 bits (424), Expect = 2e-44 Identities = 79/111 (71%), Positives = 91/111 (81%) Frame = +3 Query: 12 RHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLH 191 R KN+GLGFKTPREAI+G YID KCPFTG VSIRGRIL G KMQRTI++RR+YLH Sbjct: 34 RFWKNIGLGFKTPREAIDGAYIDSKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLH 93 Query: 192 YLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 344 ++ KY R+EKRH N+ H+SPCFR V+ GD V IG+CRPLSKTVRFNVLKV Sbjct: 94 FVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHVIIGQCRPLSKTVRFNVLKV 143 >At1g49400.1 68414.m05537 ribosomal protein S17 family protein similar to 40S ribosomal protein S17 GI:1620985 from [Nicotiana plumbaginifolia] Length = 116 Score = 38.7 bits (86), Expect = 0.002 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +3 Query: 132 GVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDV-EIGDIVTIGECRP 308 G V KMQ+++V+ D L + YNR+ KR H +D IGD V + RP Sbjct: 6 GTVVSNKMQKSVVVAVDRLFHNKIYNRYVKRTSKFMAHDD---KDACNIGDRVKLDPSRP 62 Query: 309 LSKTVRFNVLKV 344 LSK + V ++ Sbjct: 63 LSKNKHWIVAEI 74 >At3g18880.1 68416.m02398 ribosomal protein S17 family protein similar to 40S ribosomal protein S17 GB:Y08858 from [Nicotiana plumbaginifolia] Length = 105 Score = 36.7 bits (81), Expect = 0.007 Identities = 23/66 (34%), Positives = 31/66 (46%) Frame = +3 Query: 120 RILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGE 299 + + G V KMQ ++V+ D L + YNR+ KR H IGD V + Sbjct: 2 KAVIGTVVSNKMQMSVVVAVDRLFHNNIYNRYVKRTSKFMAHDEK--DSCNIGDRVKLDP 59 Query: 300 CRPLSK 317 RPLSK Sbjct: 60 SRPLSK 65 >At1g79850.1 68414.m09328 30S ribosomal protein S17, chloroplast / CS17 (RPS17) identical to 30S ribosomal protein S17, chloroplast precursor GB:P16180 [Arabidopsis thaliana] Length = 149 Score = 31.5 bits (68), Expect = 0.28 Identities = 21/75 (28%), Positives = 34/75 (45%) Frame = +3 Query: 120 RILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGE 299 + + G V +T+ + L PKY R + + H P ++GD+V + + Sbjct: 51 KTMQGRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAH-DPD-NQFKVGDVVRLEK 108 Query: 300 CRPLSKTVRFNVLKV 344 RP+SKT F L V Sbjct: 109 SRPISKTKSFVALPV 123 >At4g26980.1 68417.m03882 expressed protein Length = 343 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 42 KTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVQK 146 + PREA+ +D+ PF ++ + ++TGVVQK Sbjct: 242 EVPREALPDVALDE--PFVKDIDPKTWVVTGVVQK 274 >At4g12390.1 68417.m01958 invertase/pectin methylesterase inhibitor family protein low similarity to pectinesterase from Arabidopsis thaliana SP|Q42534, Lycopersicon esculentum SP|Q43143; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 206 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 117 GRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRN 233 G+++ GVV+ +R + + R + L NRF RH++ Sbjct: 168 GKVMDGVVKSAIRRRVVHVARVTSNALALVNRFAARHKS 206 >At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 979 Score = 27.1 bits (57), Expect = 5.9 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 6/88 (6%) Frame = +2 Query: 47 SQRGD*GYLH*QEVSLHWQRFD-PRAHPH-----RRRSEDEDAENYRDPPRLPSLPTQIQ 208 S+R D G +H EVS W+R + P++ RRRS D R P LP + Sbjct: 666 SKRHDPGKVHSVEVSERWERREQPKSRQRDLREKRRRSRSRDHGQDRQKRSSP-LPRAEK 724 Query: 209 *VRETAQEHVRTFVALLQGRGDW*YCND 292 + H +++ R +CND Sbjct: 725 ATSRHKRNHEERSENVVKDRSGKHHCND 752 >At2g24070.1 68415.m02875 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 609 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 58 RLRVPTLTRSVPSLATFRSAGASSPASF 141 R PT TR PS R+A +SSP SF Sbjct: 52 RSPTPTKTRRCPSPIVTRTAPSSSPESF 79 >At1g17210.1 68414.m02097 expressed protein distantly related to dentin phosphoryn [Homo sapiens] (GI:4322670) Length = 958 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 37 ASKLPERRLRVPTLTRSVPSLATFRSAGASSPA 135 AS P R R + S P A SAGASSPA Sbjct: 27 ASATPVDRFRRRARSPSPPQTAAASSAGASSPA 59 >At5g55920.1 68418.m06975 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}, SP|P40991 Nucleolar protein NOP2 {Saccharomyces cerevisiae}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 682 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 110 DPRAHPHRRRSEDEDAENYRDPPRLPSLPTQIQ 208 +P R +E+E E R PP LP L T+I+ Sbjct: 187 EPEHDAFRLPTEEELEEEARGPPDLPLLKTRIE 219 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 140 SEDEDAENYRDPPRLPSLPTQIQ*VRETAQEHVRTFVALLQG 265 S+ EDA DP +P++ I+ T +EH+ + L +G Sbjct: 1470 SDIEDAYYNEDPDEIPTIKLNIEQFGMTLREHMERNMELQEG 1511 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,269,797 Number of Sequences: 28952 Number of extensions: 171845 Number of successful extensions: 416 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -