BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0279 (547 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061423-1|AAL28971.1| 204|Drosophila melanogaster LD35644p pro... 143 2e-34 AE014297-125|AAN13286.1| 204|Drosophila melanogaster CG1057-PB,... 143 2e-34 AE014297-124|AAF52111.1| 204|Drosophila melanogaster CG1057-PA,... 143 2e-34 BT001465-1|AAN71220.1| 133|Drosophila melanogaster GM28912p pro... 40 0.002 BT001447-1|AAN71202.1| 202|Drosophila melanogaster GH26583p pro... 29 3.1 AE014297-4309|AAF56848.1| 319|Drosophila melanogaster CG11841-P... 29 3.1 AY058590-1|AAL13819.1| 446|Drosophila melanogaster LD28275p pro... 29 4.1 AE014296-2508|AAF49638.2| 446|Drosophila melanogaster CG7275-PA... 29 4.1 AE014297-3242|AAF56070.1| 354|Drosophila melanogaster CG4704-PA... 28 9.5 >AY061423-1|AAL28971.1| 204|Drosophila melanogaster LD35644p protein. Length = 204 Score = 143 bits (346), Expect = 2e-34 Identities = 59/88 (67%), Positives = 78/88 (88%) Frame = +2 Query: 284 GKVMPETEEQNRIRFQVELEFVQCLANPNYIHFLAQRGYLKEQTFVNYLKYLQYWREPEY 463 GK E+EE + R+Q+ELEFVQCL+NPNY++FLAQRG+ K+Q+F+NYLKYLQYW+EP+Y Sbjct: 8 GKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDY 67 Query: 464 ARYLKYPMCLHFLELLQHEAFRRECVSA 547 A+YL YPMCL+FL+LLQ+E FRRE V++ Sbjct: 68 AKYLMYPMCLYFLDLLQYEHFRREIVNS 95 >AE014297-125|AAN13286.1| 204|Drosophila melanogaster CG1057-PB, isoform B protein. Length = 204 Score = 143 bits (346), Expect = 2e-34 Identities = 59/88 (67%), Positives = 78/88 (88%) Frame = +2 Query: 284 GKVMPETEEQNRIRFQVELEFVQCLANPNYIHFLAQRGYLKEQTFVNYLKYLQYWREPEY 463 GK E+EE + R+Q+ELEFVQCL+NPNY++FLAQRG+ K+Q+F+NYLKYLQYW+EP+Y Sbjct: 8 GKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDY 67 Query: 464 ARYLKYPMCLHFLELLQHEAFRRECVSA 547 A+YL YPMCL+FL+LLQ+E FRRE V++ Sbjct: 68 AKYLMYPMCLYFLDLLQYEHFRREIVNS 95 >AE014297-124|AAF52111.1| 204|Drosophila melanogaster CG1057-PA, isoform A protein. Length = 204 Score = 143 bits (346), Expect = 2e-34 Identities = 59/88 (67%), Positives = 78/88 (88%) Frame = +2 Query: 284 GKVMPETEEQNRIRFQVELEFVQCLANPNYIHFLAQRGYLKEQTFVNYLKYLQYWREPEY 463 GK E+EE + R+Q+ELEFVQCL+NPNY++FLAQRG+ K+Q+F+NYLKYLQYW+EP+Y Sbjct: 8 GKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDY 67 Query: 464 ARYLKYPMCLHFLELLQHEAFRRECVSA 547 A+YL YPMCL+FL+LLQ+E FRRE V++ Sbjct: 68 AKYLMYPMCLYFLDLLQYEHFRREIVNS 95 >BT001465-1|AAN71220.1| 133|Drosophila melanogaster GM28912p protein. Length = 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = +2 Query: 479 YPMCLHFLELLQHEAFRRECVSA 547 YPMCL+FL+LLQ+E FRRE V++ Sbjct: 2 YPMCLYFLDLLQYEHFRREIVNS 24 >BT001447-1|AAN71202.1| 202|Drosophila melanogaster GH26583p protein. Length = 202 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 386 AQRGYLKEQTFVNYLKYLQYWREPEYARYLKYPMCLHFLELLQHEAF 526 A G+ Q + N + +Q RE ++ RY K+P CL F + QHE+F Sbjct: 38 AHPGFENPQLY-NDIGIVQLDREVKFNRY-KHPACLPFDDGEQHESF 82 >AE014297-4309|AAF56848.1| 319|Drosophila melanogaster CG11841-PA protein. Length = 319 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 386 AQRGYLKEQTFVNYLKYLQYWREPEYARYLKYPMCLHFLELLQHEAF 526 A G+ Q + N + +Q RE ++ RY K+P CL F + QHE+F Sbjct: 155 AHPGFENPQLY-NDIGIVQLDREVKFNRY-KHPACLPFDDGEQHESF 199 >AY058590-1|AAL13819.1| 446|Drosophila melanogaster LD28275p protein. Length = 446 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 398 NLAVPKSECNLDLLSTAQIQVPLEILFD 315 N V +CNL T ++Q PL++ FD Sbjct: 253 NFTVANEDCNLYTFDTRKLQTPLKVHFD 280 >AE014296-2508|AAF49638.2| 446|Drosophila melanogaster CG7275-PA protein. Length = 446 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 398 NLAVPKSECNLDLLSTAQIQVPLEILFD 315 N V +CNL T ++Q PL++ FD Sbjct: 253 NFTVANEDCNLYTFDTRKLQTPLKVHFD 280 >AE014297-3242|AAF56070.1| 354|Drosophila melanogaster CG4704-PA protein. Length = 354 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 175 YYFGHRFVETYTTDQLV*FXXXXXLQLHIFRVQN 276 ++FGHR +T + D+ + F +++H + QN Sbjct: 151 HFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQN 184 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,176,078 Number of Sequences: 53049 Number of extensions: 442496 Number of successful extensions: 1181 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2069139900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -