BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0278 (411 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0016 - 10623796-10625317,10626493-10627541 27 5.8 02_04_0326 - 22058648-22058659,22058660-22058812,22059412-22059654 27 7.7 >06_02_0016 - 10623796-10625317,10626493-10627541 Length = 856 Score = 27.1 bits (57), Expect = 5.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 258 LAIVLFFLGNFGI-TAGAHRLWSHNGYKVKLALEIL--LMVFNSIAFQN 395 + IV+ LG G AG+ R W +GY + LA+ +L +M+ + + N Sbjct: 787 MVIVVDLLGLLGAYAAGSCRDWETSGYVIALAVVVLACIMIHFMLLYHN 835 >02_04_0326 - 22058648-22058659,22058660-22058812,22059412-22059654 Length = 135 Score = 26.6 bits (56), Expect = 7.7 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 231 TSAKLATSVLAIVLFFLGNFGITAGAHRLWSHNGYKVKLALEILLMVF 374 +S + A V IV+ + +FGI G+ H+G +V + +LMVF Sbjct: 84 SSQRNAAVVGNIVIVLVNSFGIL-GSDFTTKHHGREVTFTVSAILMVF 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,263,354 Number of Sequences: 37544 Number of extensions: 188381 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -