BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0275 (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 28 1.0 SPBC1685.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 4.1 SPCC613.07 |||zf-HIT|Schizosaccharomyces pombe|chr 3|||Manual 25 9.4 SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|S... 25 9.4 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 27.9 bits (59), Expect = 1.0 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = -1 Query: 329 FDTIVIIKIDYLFHSIIHSHRSCLI*IHVLVNIRSLSF 216 FDT+ ++ + ++ +I+SH ++ + L N+ +L+F Sbjct: 399 FDTLTVLLLTWINPYVINSHTGLILALFYLTNLIALAF 436 >SPBC1685.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 25.8 bits (54), Expect = 4.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 90 SI*SLLCSDMLTQSTGRQMRLSTVW*SFDICIQLE 194 S+ SLL S + + + RQ+ S W +C++LE Sbjct: 273 SVLSLLTSTLHSLESARQIADSNTWKPIIVCLELE 307 >SPCC613.07 |||zf-HIT|Schizosaccharomyces pombe|chr 3|||Manual Length = 345 Score = 24.6 bits (51), Expect = 9.4 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -3 Query: 177 YQMITIQ*ITSSAYLWTESTYHYTTNSKLTSSKYQPSC 64 +++ TI TS+ + TES+Y +++ + S SC Sbjct: 233 FEVPTIHVFTSTTQVHTESSYETSSSEQSDDSSSSSSC 270 >SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 24.6 bits (51), Expect = 9.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 383 RQFQRDYIEIKKSVKNLPFDTIV 315 RQFQRD + I+ +V LP I+ Sbjct: 87 RQFQRDMLRIESTVIVLPTSNIL 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,980,670 Number of Sequences: 5004 Number of extensions: 37451 Number of successful extensions: 74 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -