BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0275 (533 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0042 - 14055885-14056142,14057508-14057774,14057859-140592... 29 3.1 >09_04_0042 - 14055885-14056142,14057508-14057774,14057859-14059292, 14059378-14059539,14059642-14059768,14059869-14060200, 14060289-14061083,14061379-14061714,14061791-14062730, 14063338-14063588 Length = 1633 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 368 DYIEIKKSVKNLPFDTIVIIKI-DYLFHSIIHSHRSCLI 255 DY++IK P + V++ I YLFH+ H H L+ Sbjct: 302 DYVKIKCIASGKPSERFVLVCIVAYLFHASSHHHYKTLM 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,035,337 Number of Sequences: 37544 Number of extensions: 184237 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -