BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0275 (533 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 23 4.9 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 23 4.9 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 8.5 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 159 VW*SFDICIQLEYARCIDSKGQRPNVNQNVYSYQTR 266 +W +C+ LE+A + + G + + +S +TR Sbjct: 1 MWLPLALCVLLEFADIVSASGGLDDALEVTFSERTR 36 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 159 VW*SFDICIQLEYARCIDSKGQRPNVNQNVYSYQTR 266 +W +C+ LE+A + + G + + +S +TR Sbjct: 1 MWLPLALCVLLEFADIVSASGGLDDALEVTFSERTR 36 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 294 FSFNHSFASVVFDMNTRS 241 F NH F +++D TRS Sbjct: 419 FHCNHPFVFLIYDYGTRS 436 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 482,692 Number of Sequences: 2352 Number of extensions: 8317 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -