BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0274 (557 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6LFK5 Cluster: RNA-binding protein, putative; n=1; Pla... 34 2.0 UniRef50_A4UC09 Cluster: Putative uncharacterized protein; n=2; ... 34 2.0 UniRef50_UPI0000DC0CD1 Cluster: UPI0000DC0CD1 related cluster; n... 33 3.4 UniRef50_Q3HS75 Cluster: 33k; n=2; Porcine adenovirus 3|Rep: 33k... 33 6.0 UniRef50_Q11ZK6 Cluster: Putative uncharacterized protein; n=1; ... 33 6.0 UniRef50_Q54NA5 Cluster: Putative uncharacterized protein; n=1; ... 33 6.0 UniRef50_Q5CGT9 Cluster: Putative uncharacterized protein; n=2; ... 32 7.9 >UniRef50_Q6LFK5 Cluster: RNA-binding protein, putative; n=1; Plasmodium falciparum 3D7|Rep: RNA-binding protein, putative - Plasmodium falciparum (isolate 3D7) Length = 582 Score = 34.3 bits (75), Expect = 2.0 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = +1 Query: 310 SYKNMPRCIHNYVRISLKTNREKTSASLDLRQFSVNCGMVISFIKDCCNYRNVNLSMTIV 489 ++KN P Y +I KT+ T+AS + +N MV+S I+ N N++ T Sbjct: 39 TFKNFPGLNQKYCQIEFKTSEGITNASRLNGESLLNVPMVVSVIEPIINNTNLSELSTTE 98 Query: 490 IDKRI 504 DK + Sbjct: 99 CDKNV 103 >UniRef50_A4UC09 Cluster: Putative uncharacterized protein; n=2; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 550 Score = 34.3 bits (75), Expect = 2.0 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +1 Query: 256 SIVINGSMPFCQNTGFL-ESYKNMPRCIHNYVRISLKTNREKTSASLDLRQFSVNCGMVI 432 +I++N ++P C L Y + R + V +L + EK+ ++D+ NC +++ Sbjct: 318 AILVN-TLPSCYWMLLLIHLYPELHRELQKEVDAALLIDEEKSHITIDITSVKNNCPLLL 376 Query: 433 SFIKDCCNYRNVNLSMTIV 489 S K+ YR + ++ IV Sbjct: 377 STFKESLRYRGMGTALRIV 395 >UniRef50_UPI0000DC0CD1 Cluster: UPI0000DC0CD1 related cluster; n=1; Rattus norvegicus|Rep: UPI0000DC0CD1 UniRef100 entry - Rattus norvegicus Length = 270 Score = 33.5 bits (73), Expect = 3.4 Identities = 23/87 (26%), Positives = 38/87 (43%) Frame = -3 Query: 525 HTVYLITYSLIDYYRHR*VHITIVTAIFNKTYHHTTIYRKLTQIE*RRSFLSIRLQRYTY 346 H VY T++ I + H HI T I + H +Y + + S+ + R Y Sbjct: 26 HNVYPYTHTHIHTHTHIHAHIHTCTHIHTHLHTHEYLYSHIYIYLHACTHRSVFIHRDMY 85 Query: 345 IVMYTSWHIFVRLQKARVLTKWHAAIY 265 I YT H+++ + + K H +IY Sbjct: 86 INTYTYIHMYINMYTHMHVYK-HVSIY 111 >UniRef50_Q3HS75 Cluster: 33k; n=2; Porcine adenovirus 3|Rep: 33k - Porcine adenovirus 3 (PAdV-3) Length = 287 Score = 32.7 bits (71), Expect = 6.0 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +1 Query: 25 SRGSSHVSKKQASVVAPHAFRWSEENRGRNTSKQV*SLATEASAGHPSHAASTIESSTPR 204 S S +S+++ SVV A RW++ + R++ + A A+A P+H + P Sbjct: 111 SSSSKSISQRRNSVVPSEARRWNQTSIHRSSQPAISRKAAAAAAAEPAHVSQLRAKIFPT 170 Query: 205 VLSV 216 + ++ Sbjct: 171 LYAI 174 >UniRef50_Q11ZK6 Cluster: Putative uncharacterized protein; n=1; Polaromonas sp. JS666|Rep: Putative uncharacterized protein - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 411 Score = 32.7 bits (71), Expect = 6.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 1 CRNSARGKSRGSSHVSKKQASVVAPHAFRWSEENRG 108 C+ +G SR +SH+++K+A H F W G Sbjct: 33 CKTKVKGDSRTTSHITQKRAFQNVMHVFEWLRRELG 68 >UniRef50_Q54NA5 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1192 Score = 32.7 bits (71), Expect = 6.0 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 1/86 (1%) Frame = -3 Query: 522 TVYLITYSLIDYYRHR*VHITIVTAIFNKTY-HHTTIYRKLTQIE*RRSFLSIRLQRYTY 346 TV+L+++ L D R HIT++T F+K Y + I K+++++ + F + Sbjct: 603 TVFLLSHKLWDKKSGRRQHITMITKTFSKWYINILKIKIKISKVDYPKDFPQF------H 656 Query: 345 IVMYTSWHIFVRLQKARVLTKWHAAI 268 I + + I ++ + RVL KW ++ Sbjct: 657 ITLKERFKIIWKIIEKRVLGKWRYSL 682 >UniRef50_Q5CGT9 Cluster: Putative uncharacterized protein; n=2; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium hominis Length = 537 Score = 32.3 bits (70), Expect = 7.9 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 292 NTGFLESYKNMPRCIHNYVRISLKTNREKTSASLDLRQFSVNCGMVISFIKDC 450 N + Y+N + I + V + +++ EK +ASL + Q S+ + FI+DC Sbjct: 341 NFAYSRFYRNNRKVISDIVTLKTRSSEEKLAASLAIGQ-SIRLSLFEDFIEDC 392 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,137,151 Number of Sequences: 1657284 Number of extensions: 9595266 Number of successful extensions: 24111 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24095 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37071859483 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -