BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0273 (496 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 27 0.35 Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. 27 0.35 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 27 0.35 AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-tran... 25 1.1 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 1.4 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 25 1.9 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 25 1.9 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 25 1.9 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 24 2.5 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 24 2.5 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 2.5 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 24 3.3 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 4.3 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 23 5.7 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 23 5.7 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 23 7.6 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 22 10.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 22 10.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 22 10.0 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 10.0 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 27.1 bits (57), Expect = 0.35 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 473 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. Length = 140 Score = 27.1 bits (57), Expect = 0.35 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 473 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 27.1 bits (57), Expect = 0.35 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 473 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-transferase D7 protein. Length = 218 Score = 25.4 bits (53), Expect = 1.1 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 4/79 (5%) Frame = +3 Query: 240 LLAELKTISLKVTTVDM---QKPPPDFRTNFEATHP-PILIDNGLAILENEKIERHIMKS 407 LLA++ + L++ +++ ++ PDF H P L D+GL + E+ I +++ + Sbjct: 19 LLAKMIGVELELKALNVMEGEQLKPDF-VELNPQHCIPTLDDHGLVLWESRVILAYLVSA 77 Query: 408 VPGGHNLFVQDKEVASLIE 464 NL+ +D ++++ Sbjct: 78 YGKDENLYPKDFRSRAIVD 96 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.0 bits (52), Expect = 1.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +1 Query: 292 RSRPQISAPTSKRHTRPY*STMGWRYLRTRKSNGTS*SPCQGD 420 R P I +R RPY + ++ + ++G PC GD Sbjct: 490 RMEPSICREALRRVRRPYPFILDSSFVCSTTNHGDQERPCDGD 532 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 24.6 bits (51), Expect = 1.9 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI 461 P L+DNG A+ E+ I ++ + L+ +D + +++ Sbjct: 53 PTLVDNGFALWESRAICTYLAEKYGKDDKLYPKDPQKRAVV 93 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 24.6 bits (51), Expect = 1.9 Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = +3 Query: 204 CLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPP-DFRTNFEATHP-PILIDNGLAILEN 377 C F + L+A+ I L + +++ P D + H P+L+DNG + E Sbjct: 5 CNFVSPPSQSVILVAKKLGIKLNLRKINIYDPVAMDTLSKLNPHHILPMLVDNGTVVFEP 64 Query: 378 EKIERHIMKSVPGGHNLFVQDKEVASLI 461 I ++++ L+ +D V ++ Sbjct: 65 CAIVLYLVEMYAKNDALYPKDALVRCVV 92 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 24.6 bits (51), Expect = 1.9 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI 461 P L+DNG A+ E+ I ++ + L+ +D + +++ Sbjct: 53 PTLVDNGFALWESRAICTYLAEKYGKDDKLYPKDPQKRAVV 93 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 24.2 bits (50), Expect = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 71 RKYPGVPLLHNITQATRLVPNS 6 RKYPG+P+L+ VP+S Sbjct: 360 RKYPGLPILNRECTIDYKVPDS 381 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 24.2 bits (50), Expect = 2.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 206 TGALSSSIDRRCLYYKLDLR 147 +G + S + RCLY+ +DLR Sbjct: 178 SGKVEDSPETRCLYHCIDLR 197 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.2 bits (50), Expect = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 71 RKYPGVPLLHNITQATRLVPNS 6 RKYPG+P+L+ VP+S Sbjct: 360 RKYPGLPILNRECTIDYKVPDS 381 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.8 bits (49), Expect = 3.3 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 339 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLIENL 470 P L DNG + E+ I +++ + GH L+ + +LI + Sbjct: 56 PTLDDNGFYLGESRAILSYLIDAYRPGHTLYPNIPKEKALINRV 99 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.4 bits (48), Expect = 4.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 319 LVRKSGGGFCMSTVVTFKLI 260 LVRK GGG MS++ L+ Sbjct: 506 LVRKKGGGDAMSSIRPISLL 525 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 23.0 bits (47), Expect = 5.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 63 PGSTSITQYHTSNTPRAE 10 PG+ +T HT NTP A+ Sbjct: 55 PGARYLTLTHTCNTPWAD 72 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 23.0 bits (47), Expect = 5.7 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +3 Query: 249 ELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKSVPGGHNL 428 EL+ ++ + T D KP + N + T P +L DNG I E+ I +++ +L Sbjct: 28 ELEQKTINLLTGDHLKPE-FVKLNPQHTIP-VLDDNGTIITESHAIMIYLVTKYGKDDSL 85 Query: 429 FVQD 440 + +D Sbjct: 86 YPKD 89 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 22.6 bits (46), Expect = 7.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 77 SARKYPGVPLLHNITQATRLVPNS 6 S RKYP VP+ +T VP++ Sbjct: 362 SLRKYPPVPMHFRMTAQDYRVPDT 385 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 22.2 bits (45), Expect = 10.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 71 RKYPGVPLLHNITQATRLVPN 9 R YP V LH IT +PN Sbjct: 365 RLYPPVATLHRITTQPYQLPN 385 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.2 bits (45), Expect = 10.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 108 DEIAENGTANGDVPE 152 DE A +GT NG PE Sbjct: 41 DEPAGHGTGNGTAPE 55 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.2 bits (45), Expect = 10.0 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -3 Query: 116 DFIRHRDLGNT*TSARKYPGVPLL 45 D+ ++DLG+ + RK+ +P+L Sbjct: 837 DYPHNQDLGSAGSCVRKFSTLPIL 860 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.2 bits (45), Expect = 10.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 108 PTS*FRKHLNFSKEVPGSTSITQYHTS 28 P R+H+ KEV + +TQY T+ Sbjct: 1116 PQRRIRQHMPQQKEVVELSDVTQYATA 1142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,173 Number of Sequences: 2352 Number of extensions: 12123 Number of successful extensions: 100 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -