BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0273 (496 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 31 0.32 At3g10815.1 68416.m01302 zinc finger (C3HC4-type RING finger) fa... 30 0.98 At5g17960.1 68418.m02106 DC1 domain-containing protein contains ... 29 2.3 At4g13130.1 68417.m02045 DC1 domain-containing protein contains ... 29 2.3 At1g10190.1 68414.m01149 expressed protein similar to hypothetic... 29 2.3 At5g16710.1 68418.m01956 dehydroascorbate reductase, putative St... 28 3.0 At4g15050.1 68417.m02311 expressed protein contains Pfam profil... 28 3.0 At2g27035.1 68415.m03248 plastocyanin-like domain-containing pro... 28 4.0 At2g23100.1 68415.m02756 DC1 domain-containing protein contains ... 27 5.3 At1g72960.1 68414.m08438 root hair defective 3 GTP-binding (RHD3... 27 9.2 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 31.5 bits (68), Expect = 0.32 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = +3 Query: 219 EYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIE-RH 395 +Y MD+Y A + I+ K TT+++ K + + E + + +AI ENEK + R Sbjct: 300 KYTMDMYNSACKEAIAAKKTTIELHKWKEERKHKLE--EAILAKEAAMAIAENEKAKSRA 357 Query: 396 IMKSVPGGHNLFVQDKEVASLIE 464 M+++ H + + + IE Sbjct: 358 AMEALEAAHRMAETEAQKRKQIE 380 >At3g10815.1 68416.m01302 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 199 Score = 29.9 bits (64), Expect = 0.98 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 183 DGRRKGACLFCQEYFMD-LYLLAELKTISL 269 +GRR+GAC++C F++ LY EL L Sbjct: 24 EGRREGACIYCGNTFLERLYENVELSPFDL 53 >At5g17960.1 68418.m02106 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 599 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -3 Query: 206 TGALSSSIDRRC---LYYKLDLRNVSISCTIFC 117 T + S + RC +Y+K+D+RNV SC + C Sbjct: 566 TRPVCSRCEDRCQGSIYFKVDVRNVCASCLLKC 598 >At4g13130.1 68417.m02045 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 767 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 204 CLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILI 350 C C EY MD Y ++ V+ ++KPPP + H LI Sbjct: 278 CYCCDEYLMDYYYYCSSCDFAMNVSC--LEKPPPVLSIDHPKWHQHPLI 324 >At1g10190.1 68414.m01149 expressed protein similar to hypothetical protein GB:CAB10284 contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 396 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 298 RPQISAPTSKRHTRPY*STMGWRYLRTRKSNGTS 399 +P P+ K HT Y W+ +R RK+N T+ Sbjct: 69 QPAFDHPSMKNHTYHYKMRPIWKRMRERKTNNTN 102 >At5g16710.1 68418.m01956 dehydroascorbate reductase, putative Strong similarity to dehydroascorbate reductase [Spinacia oleracea] gi:10952512 gb:AAG24945 Length = 258 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 153 IELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDF 311 +E+ +KAS + G C FCQ+ + L E K + + VD+ P F Sbjct: 49 LEICVKASITTPNKLGDCPFCQK----VLLTMEEKNVPYDMKMVDLSNKPEWF 97 >At4g15050.1 68417.m02311 expressed protein contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 396 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 298 RPQISAPTSKRHTRPY*STMGWRYLRTRKSNGTS 399 +P P+ K HT Y W+ +R RK+N T+ Sbjct: 69 QPAFDHPSMKNHTYHYKMRPIWKGMRERKTNNTN 102 >At2g27035.1 68415.m03248 plastocyanin-like domain-containing protein low similarity to SP:P80728 Mavicyanin {Cucurbita pepo}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 163 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 252 LKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGL 362 LK + L +T + +PPP TNF +T P++ N + Sbjct: 115 LKGMKLAITV--LPQPPPSAPTNFTSTTTPLIPPNAI 149 >At2g23100.1 68415.m02756 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 711 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 198 GACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPIL 347 G C CQ+ F D+Y + SL T KPPP T+ + +H IL Sbjct: 223 GKCKCCQKRFEDIYYHCSVCNFSLNFTCT--IKPPPLTITHLK-SHSHIL 269 >At1g72960.1 68414.m08438 root hair defective 3 GTP-binding (RHD3) family protein contains Pfam profile: PF05879 root hair defective 3 GTP-binding protein (RHD3) Length = 748 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 417 PLARTS*CAVRFSRSQVSPAHCRSVW 340 PLA ++ V SR+ ++P C+S+W Sbjct: 582 PLASSTWDEVPSSRTLITPVQCKSIW 607 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,408,540 Number of Sequences: 28952 Number of extensions: 239008 Number of successful extensions: 544 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 544 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -