BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0272 (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 66 1e-12 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 25 2.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 65.7 bits (153), Expect = 1e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 492 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIIN 593 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIIN Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIIN 34 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 451 EGNCRSLSWQNCGRMQLSRFPRTS 522 E N + L+ QNCGR+ +S R S Sbjct: 317 EFNYKELNCQNCGRLFISNNGRVS 340 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,943 Number of Sequences: 2352 Number of extensions: 14171 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -