BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0269 (590 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CC8D1 Cluster: hypothetical protein TTHERM_0029... 33 5.0 UniRef50_Q6RCQ4 Cluster: SidH; n=2; Legionella pneumophila|Rep: ... 33 5.0 >UniRef50_UPI00006CC8D1 Cluster: hypothetical protein TTHERM_00292060; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00292060 - Tetrahymena thermophila SB210 Length = 1106 Score = 33.1 bits (72), Expect = 5.0 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = -1 Query: 275 SKKKHFL*RCFYKDNINPCPNKYVIHYDIEKPT*FQDRL*QL*IFLNISKISSSD 111 ++KK+ L F KD I+ C NKY I+Y EK F + QL L +++ SD Sbjct: 845 TRKKYHL-NTFQKDIISICQNKYAINYLQEKKYEFNNLEEQLTNILTMNEFDDSD 898 >UniRef50_Q6RCQ4 Cluster: SidH; n=2; Legionella pneumophila|Rep: SidH - Legionella pneumophila Length = 2225 Score = 33.1 bits (72), Expect = 5.0 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -1 Query: 146 IFLNISKISSSDLDVNKTIREVNPFEQKKKKKTRD 42 I LN + + + +D+N T++E+N ++ KKTRD Sbjct: 1774 ILLNNNPLKEAYVDLNNTLKEINTLLDEENKKTRD 1808 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,678,776 Number of Sequences: 1657284 Number of extensions: 9747396 Number of successful extensions: 21000 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20992 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41073165837 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -