BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0267 (483 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2UGG3 Cluster: ATP-dependent DNA helicase; n=3; Euroti... 37 0.21 UniRef50_Q4VKA1 Cluster: O antigen polymerase; n=2; Escherichia ... 33 2.6 >UniRef50_Q2UGG3 Cluster: ATP-dependent DNA helicase; n=3; Eurotiomycetidae|Rep: ATP-dependent DNA helicase - Aspergillus oryzae Length = 539 Score = 37.1 bits (82), Expect = 0.21 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 67 YERSKRPPGNGATKESTTS*LANRTNIQRWFRNTLRHCESTN 192 Y R+ + P NG +K+ S L N+ R F+ +R+CEST+ Sbjct: 410 YNRANKKPANGVSKDDPNSNLQNQYARLRSFQKVVRYCESTS 451 >UniRef50_Q4VKA1 Cluster: O antigen polymerase; n=2; Escherichia coli|Rep: O antigen polymerase - Escherichia coli Length = 395 Score = 33.5 bits (73), Expect = 2.6 Identities = 16/22 (72%), Positives = 21/22 (95%) Frame = +3 Query: 375 LFFFLYLGSLASALFSGAISIH 440 LFFFL+L S+ASALFSGA++I+ Sbjct: 71 LFFFLFL-SVASALFSGAVTIY 91 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 462,843,250 Number of Sequences: 1657284 Number of extensions: 8785516 Number of successful extensions: 22383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22383 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27710252790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -