BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0265 (414 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 26 0.13 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 1.2 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 22 2.7 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 21 3.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 6.3 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 26.2 bits (55), Expect = 0.13 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 255 VIHYCISILLLSHIKYFHPL 196 +I C+S ++ ++K+FHPL Sbjct: 33 IIAGCVSPFVIGYVKHFHPL 52 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.0 bits (47), Expect = 1.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 274 SFIEKTLHHNYCGSYFTFIYTCSL 345 +F E T+H C Y TF+ L Sbjct: 425 NFNENTIHSKLCKLYATFLIALKL 448 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.8 bits (44), Expect = 2.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 231 LLLSHIKYFHPLNTKT 184 L L+H K FHP +T++ Sbjct: 250 LFLTHRKPFHPASTQS 265 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 3 YLFYPSFNPITGIYAIVKQLCIHDYVLL*SKKI 101 YL + F P+ +A L H Y ++ +K++ Sbjct: 278 YLPFAQFGPVIDSWATQPVLPTHPYQIIKNKQV 310 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 20.6 bits (41), Expect = 6.3 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 369 LISLKQKCQGTCIYEREI 316 L+S+++KC +Y+ E+ Sbjct: 468 LVSIQRKCNHGLVYDLEL 485 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,813 Number of Sequences: 336 Number of extensions: 2106 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9068614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -