BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0265 (414 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1A4.06c |||mitochondrial matrix protein import protein|Schiz... 27 1.2 SPBC119.06 |sco1||copper chaperone Sco1|Schizosaccharomyces pomb... 24 8.1 >SPBC1A4.06c |||mitochondrial matrix protein import protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 383 Score = 27.1 bits (57), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 131 MLKYITAKWLYRHSYS 178 +L+Y T +W+ RHSYS Sbjct: 13 ILRYSTKRWMNRHSYS 28 >SPBC119.06 |sco1||copper chaperone Sco1|Schizosaccharomyces pombe|chr 2|||Manual Length = 263 Score = 24.2 bits (50), Expect = 8.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 9 FYPSFNPITGIYAIVKQLCIHDYVLL*SKKIIAKTLDDYVL 131 F P +TG Y +K +C V + K I DDY++ Sbjct: 180 FNPKIVGLTGSYEEIKDICKKFRVYFSTPKNIDPKKDDYLV 220 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,714,146 Number of Sequences: 5004 Number of extensions: 33139 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -