BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0263 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 9.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.2 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 20.6 bits (41), Expect = 9.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 228 SCAGSFCSASADSPSPLH 175 S GS+ S+S DSP H Sbjct: 62 SLEGSYDSSSGDSPVSSH 79 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 9.2 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -3 Query: 216 SFCSASADSPSPLHVGGPQREVVPQQLHDERGVLVALLXERVQF 85 S CS + S L R+ +P ++ + A L ERV++ Sbjct: 17 SRCSVRCSAASGLRWFEIWRDSLPTKMRELNATACAALYERVEW 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,832 Number of Sequences: 438 Number of extensions: 1487 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -