BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0262 (595 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF480924-3|AAM81188.1| 863|Homo sapiens pol protein protein. 36 0.11 U87595-1|AAB63117.1| 197|Homo sapiens polymerase protein. 31 3.1 U87589-1|AAB63112.1| 197|Homo sapiens polymerase protein. 31 3.1 DQ264729-1|ABB72674.1| 1132|Homo sapiens telomerase reverse tran... 31 3.1 AY007685-1|AAG23289.1| 1132|Homo sapiens telomerase catalytic su... 31 3.1 AK130656-1|BAC85402.1| 181|Homo sapiens protein ( Homo sapiens ... 31 3.1 AF128894-1|AAD30037.1| 1132|Homo sapiens telomerase reverse tran... 31 3.1 AF018167-1|AAC51724.1| 1132|Homo sapiens telomerase catalytic su... 31 3.1 AF015950-1|AAC51672.1| 1132|Homo sapiens telomerase reverse tran... 31 3.1 AB085628-1|BAC11010.1| 1069|Homo sapiens telomerase reverse tran... 31 3.1 >AF480924-3|AAM81188.1| 863|Homo sapiens pol protein protein. Length = 863 Score = 35.9 bits (79), Expect = 0.11 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = -3 Query: 524 ISEDSYQSRIVWKGLPQGSVLSPLLYNIYSHDLEASLR---GKVNTLQYADDLLLYVSGD 354 I+ R WK LPQG SP + +Y +R KV L Y DDLL+ + Sbjct: 139 INHQGPDKRYEWKVLPQGMTNSPAICQLYVDQAVEPVRQQCPKVQILHYMDDLLITAESE 198 Query: 353 S 351 S Sbjct: 199 S 199 >U87595-1|AAB63117.1| 197|Homo sapiens polymerase protein. Length = 197 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = -3 Query: 533 LKVISEDSYQSRIVWKGLPQGSVLSPLLYNIYSHDLEASLRGKVN---TLQYADDLLLYV 363 + I+ +R WK LPQG + SP + + + +R K + + Y DD+L Sbjct: 70 IPAINNKEPATRFQWKVLPQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDIL--C 127 Query: 362 SGDSIDNMSDTVTY 321 + ++ D + D T+ Sbjct: 128 AAETRDKLIDCYTF 141 >U87589-1|AAB63112.1| 197|Homo sapiens polymerase protein. Length = 197 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = -3 Query: 533 LKVISEDSYQSRIVWKGLPQGSVLSPLLYNIYSHDLEASLRGKVN---TLQYADDLLLYV 363 + I+ +R WK LPQG + SP + + + +R K + + Y DD+L Sbjct: 70 IPAINNKEPATRFQWKVLPQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDIL--C 127 Query: 362 SGDSIDNMSDTVTY 321 + ++ D + D T+ Sbjct: 128 AAETRDKLIDCYTF 141 >DQ264729-1|ABB72674.1| 1132|Homo sapiens telomerase reverse transcriptase protein. Length = 1132 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 >AY007685-1|AAG23289.1| 1132|Homo sapiens telomerase catalytic subunit protein. Length = 1132 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 >AK130656-1|BAC85402.1| 181|Homo sapiens protein ( Homo sapiens cDNA FLJ27146 fis, clone SPL09537. ). Length = 181 Score = 31.1 bits (67), Expect = 3.1 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 8/128 (6%) Frame = -3 Query: 590 LNIPQIFISFIINLLSGRMLKVISEDSYQSRIVWK-GLPQGSVLSPLLYNIYSHDLEASL 414 L+I ++ I + +I ++ Q K G QG LSPLL+N DL ++ Sbjct: 8 LDIDGTYVKIIRAIYDKPTANIILDEQKQEAFPLKTGTRQGCPLSPLLFNTVLEDLARAI 67 Query: 413 R--GKVNTLQYADDL--LLYVSGDSIDNMSDTVTYSLKLLKVWLDNNSLS---LSVPKSI 255 R ++ +Q ++ L ++GD I + + + + K +K+ + + +S ++V KS Sbjct: 68 RQEKEIKRIQIEREIVKLSLLAGDMILYLENHIILAQKPVKLISNFSKVSGYKINVQKSQ 127 Query: 254 IVLFSRMR 231 L+ R Sbjct: 128 AFLYINNR 135 >AF128894-1|AAD30037.1| 1132|Homo sapiens telomerase reverse transcriptase protein. Length = 1132 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 >AF018167-1|AAC51724.1| 1132|Homo sapiens telomerase catalytic subunit protein. Length = 1132 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 >AF015950-1|AAC51672.1| 1132|Homo sapiens telomerase reverse transcriptase protein. Length = 1132 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 >AB085628-1|BAC11010.1| 1069|Homo sapiens telomerase reverse transcriptase protein. Length = 1069 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 506 QSRIVWKGLPQGSVLSPLLYNIYSHDLE----ASLRGKVNTLQYADDLLL 369 +S + +G+PQGS+LS LL ++ D+E A +R L+ DD LL Sbjct: 823 KSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLL 872 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,796,813 Number of Sequences: 237096 Number of extensions: 1601993 Number of successful extensions: 2997 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2996 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6268037466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -