Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0261
         (506 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0FEA1 Cluster: Aldo/keto reductase; n=1; alpha proteob...    32   8.6  

>UniRef50_Q0FEA1 Cluster: Aldo/keto reductase; n=1; alpha
           proteobacterium HTCC2255|Rep: Aldo/keto reductase -
           alpha proteobacterium HTCC2255
          Length = 405

 Score = 31.9 bits (69), Expect = 8.6
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = -3

Query: 387 QVNSNVDFNMSKQTKTINDYDY*ENMICCK--LKTVTF--INQMLPCIKHYATLLHNKII 220
           Q+N+N+D N S +  +IND DY ++ +  K  L T+T   IN          ++ +  II
Sbjct: 326 QINNNLDINYSTKFLSINDQDYSQHRLSSKRSLGTITTLGINWEKDGFDLGGSIGYQNII 385

Query: 219 LYYSHINAGSI 187
           L  ++I+ G+I
Sbjct: 386 LDKANISNGTI 396


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 447,345,752
Number of Sequences: 1657284
Number of extensions: 7793764
Number of successful extensions: 11522
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11227
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11521
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 30528237263
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)