BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0260 (529 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69717-3|CAA93534.1| 617|Caenorhabditis elegans Hypothetical pr... 30 1.2 AL009170-1|CAA15637.1| 617|Caenorhabditis elegans Hypothetical ... 30 1.2 >Z69717-3|CAA93534.1| 617|Caenorhabditis elegans Hypothetical protein H19J13.1 protein. Length = 617 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 289 P*SSNAFRFEGWGSVVTILRP*NL-YLKVGGA--FTLWMSMGSSNH 417 P +S F E +G V T L + Y +G A F LW S+G +NH Sbjct: 299 PVASRLFALEHFGDVATFLTTCIVEYSLIGAAIMFILWKSIGQNNH 344 >AL009170-1|CAA15637.1| 617|Caenorhabditis elegans Hypothetical protein H19J13.1 protein. Length = 617 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 289 P*SSNAFRFEGWGSVVTILRP*NL-YLKVGGA--FTLWMSMGSSNH 417 P +S F E +G V T L + Y +G A F LW S+G +NH Sbjct: 299 PVASRLFALEHFGDVATFLTTCIVEYSLIGAAIMFILWKSIGQNNH 344 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,518,893 Number of Sequences: 27780 Number of extensions: 223520 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -