BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0257 (638 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21683| Best HMM Match : Fe_dep_repress (HMM E-Value=4) 29 3.2 SB_41787| Best HMM Match : Frizzled (HMM E-Value=0) 29 4.2 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 28 5.6 SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 27 9.7 >SB_21683| Best HMM Match : Fe_dep_repress (HMM E-Value=4) Length = 268 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/81 (24%), Positives = 39/81 (48%) Frame = +3 Query: 261 SNLINLEVIIDIEHELRKESGDLISLMFLLYDDPDIALVKLTAYQQSSNAYHEHSLLQDW 440 + +I V D EH+L KE + + +F + D+ + VKL Q + L Sbjct: 60 TTIIASPVPADKEHDLPKEFTNYMRALFGILDEHNTGYVKLADIQSYLDVKEGQGGLPAG 119 Query: 441 LLKAKCKLTWKHELVEGLLIC 503 +L++ K+T ++ L++ +C Sbjct: 120 ILESLYKVTPRNGLLDFESLC 140 >SB_41787| Best HMM Match : Frizzled (HMM E-Value=0) Length = 542 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 330 ISLMFLLYDDPDIALVKLTAYQQSSNAYHEHSLLQDWLLKAKC 458 I + +LY P + ++ Y+QS+ ++S ++ W + KC Sbjct: 426 IGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKC 468 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 539 FKQLKNILPNRQLHNEHTYKSCKKVI 616 F+ +KN L + ++H +H K CK V+ Sbjct: 68 FRYMKNDLDSLKIHCDHQSKGCKSVV 93 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 470 PGQLTFCL*KPILKQGMLMICITRLLISC 384 PG CL P+L+Q + ++ + + L+SC Sbjct: 1048 PGPDKLCLSLPVLEQALNLLLVNKTLMSC 1076 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,270,178 Number of Sequences: 59808 Number of extensions: 378661 Number of successful extensions: 855 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -