BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0256 (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 1.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 3.8 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 5.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 6.7 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 8.9 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 1.3 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 290 TEERMRKYLDQPIFSRIKYEH---PEYFKKIIPISGDITAPKL 409 TE KY+D IFSR + E PE + I I D TA L Sbjct: 148 TEVFPDKYMDSGIFSRAREEANVVPEGARVPIEIPRDYTASDL 190 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 3.8 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = -1 Query: 360 YSGCSYFIREKMG*SRYFLIRSSVFDPFLSRIKM*MLTMPGHEYASFSTYA----FPRNP 193 Y G Y K+ +RY+L R S P+L PG Y TY+ FP+ P Sbjct: 254 YRGEEYLYSHKLLLNRYYLERLSNDLPYLEEFDWQKPFYPG--YYPTMTYSNGLPFPQRP 311 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 242 PDTNTQVSQRTPFQGIPVAPCNKNG--FTIVKFPHGLI 135 PD N V + + +P C+K G F V +G++ Sbjct: 34 PDNNKTVREFNVYWNVPTFMCHKYGLRFEEVSEKYGIL 71 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 102 KMSHNGTLDEHYQTVREFYDGKSV 173 K HNGT YQ V ++++ + Sbjct: 407 KSEHNGTNGYQYQVVGKWFNSLDI 430 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 102 KMSHNGTLDEHYQTVREFYDGKSV 173 K HNGT YQ V ++++ + Sbjct: 497 KSEHNGTNGYQYQVVGKWFNSLDI 520 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 440 INEVSIVIHSAASVKLNDHLKFTLN 514 + +V + I + V+LN L+ TLN Sbjct: 117 VKDVLVSIDPSGMVRLNTRLQATLN 141 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 84 KFRVISKMSHNGTLDEHYQTVREF 155 KF M+H G D+ Y+ R+F Sbjct: 190 KFEPDLDMNHPGFADKEYRARRKF 213 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,732 Number of Sequences: 438 Number of extensions: 3375 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -