BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0250 (554 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 131 4e-31 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 81 5e-16 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 81 5e-16 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 69 2e-12 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 62 3e-10 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 62 3e-10 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 60 2e-09 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 59 2e-09 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 55 3e-08 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 53 1e-07 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 53 2e-07 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 45 4e-05 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 45 4e-05 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 44 1e-04 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 42 3e-04 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 40 0.001 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 40 0.001 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.015 SB_23942| Best HMM Match : 5-nucleotidase (HMM E-Value=4) 36 0.029 SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) 35 0.051 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 34 0.090 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 31 0.63 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 30 1.5 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 29 1.9 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13496| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 28 5.9 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 28 5.9 SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) 27 7.8 SB_963| Best HMM Match : CUB (HMM E-Value=1.8e-19) 27 7.8 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 131 bits (316), Expect = 4e-31 Identities = 73/178 (41%), Positives = 97/178 (54%), Gaps = 3/178 (1%) Frame = +3 Query: 27 LITNYTRFWAFLKMPGES---EIKRNYHKLAKEFHPDKNPAAGDKFKEISYAYEVLSDPK 197 ++ T ++ L +P + EIK++Y KLA ++HPDKNP GD+FK+IS AYEVLSD K Sbjct: 59 IMVKETAYYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGDRFKQISQAYEVLSDEK 118 Query: 198 KRQVYDLYXXXXXXXXXXXXXFPADEIXXXXXXXXXXXXXSRGCGQGLGPVRGEDTMHPL 377 KR++YD F + G G RG+D +H L Sbjct: 119 KRKIYDEGGEDAIKGGGEGGGFHSP-------MDIFDMFFGTGRAAHQGERRGKDMVHQL 171 Query: 378 AVTLEDLYAGKTTKLQLSKNVICAHCKGVGGKPGSLISCKDCRGQGIKVSYQQIAPHM 551 VTLE+LY G T +L L KNVIC+ C G GGK G + SC+ C G G+ V +IAP M Sbjct: 172 RVTLEELYNGATRQLALQKNVICSKCDGRGGKEGCVESCQTCHGSGMYVRINRIAPGM 229 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 81.4 bits (192), Expect = 5e-16 Identities = 35/63 (55%), Positives = 49/63 (77%), Gaps = 3/63 (4%) Frame = +3 Query: 42 TRFWAFLKMP---GESEIKRNYHKLAKEFHPDKNPAAGDKFKEISYAYEVLSDPKKRQVY 212 TR + L +P +++IK+ Y KLAKE HPDKNP G+KFK+I++AYE+LSDP+KR++Y Sbjct: 4 TRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELY 63 Query: 213 DLY 221 D Y Sbjct: 64 DRY 66 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 450 HCKGVGGKPGSLISCKDCRGQGIKVSYQQIAPHM 551 H GGKPG++ C C+G+G+KV+ + I P M Sbjct: 124 HPLKAGGKPGAMRPCAGCKGRGVKVTIKPIGPGM 157 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 81.4 bits (192), Expect = 5e-16 Identities = 35/63 (55%), Positives = 49/63 (77%), Gaps = 3/63 (4%) Frame = +3 Query: 42 TRFWAFLKMP---GESEIKRNYHKLAKEFHPDKNPAAGDKFKEISYAYEVLSDPKKRQVY 212 TR + L +P +++IK+ Y KLAKE HPDKNP G+KFK+I++AYE+LSDP+KR++Y Sbjct: 4 TRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELY 63 Query: 213 DLY 221 D Y Sbjct: 64 DRY 66 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 69.3 bits (162), Expect = 2e-12 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = +3 Query: 63 KMPGESEIKRNYHKLAKEFHPDKN--PAAGDKFKEISYAYEVLSDPKKRQVYDLY 221 K +IK+ Y K A ++HPDKN P A +KFKEIS AYEVLSDPKK+++YD Y Sbjct: 13 KAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEIYDQY 67 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 67.7 bits (158), Expect = 6e-12 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +3 Query: 36 NYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKN--PAAGDKFKEISYAYEVLSDPKKRQV 209 NY K + E+K+ Y K A ++HPDKN P A +KFKEI+ AYEVLSDP+KR++ Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREI 63 Query: 210 YDLY 221 +D Y Sbjct: 64 FDQY 67 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 64.1 bits (149), Expect = 7e-11 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 9/156 (5%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPD--KNPAAGDKFKEISYAYEVLSDPKKRQVYDLY----XXXXX 236 + EIK+ Y +LAK++HPD K+ +A +KF+E+S AYEVLSD KR+ YD + Sbjct: 72 QKEIKKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSDDGKRKAYDSFGQTDFSGAQ 131 Query: 237 XXXXXXXXFPADEIXXXXXXXXXXXXXS--RGCGQGLGPVRGEDTMHPLAVTLEDLYAGK 410 F A++I R G ++ + + + ++ + G Sbjct: 132 GGPFGGAGFDAEDILKSFFGGQSGPFGGGFRAGGMDFEDIQ-QAQQYMMNLSFMEAVKGC 190 Query: 411 TTKLQLSKNVICAHCKGVGGKPGSLIS-CKDCRGQG 515 + ++ V C C G +PG+ S C C G G Sbjct: 191 NKDITINTRVTCDRCDGKKAEPGTTHSKCTTCNGTG 226 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 62.1 bits (144), Expect = 3e-10 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 5/63 (7%) Frame = +3 Query: 48 FWAFLKMP---GESEIKRNYHKLAKEFHPDKNPAAG--DKFKEISYAYEVLSDPKKRQVY 212 ++A L +P + +IK+ Y + A FHPDKN +G +KFKEIS AY+VL+DP++R ++ Sbjct: 5 YYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRDIF 64 Query: 213 DLY 221 D+Y Sbjct: 65 DMY 67 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 62.1 bits (144), Expect = 3e-10 Identities = 44/138 (31%), Positives = 62/138 (44%), Gaps = 6/138 (4%) Frame = +3 Query: 48 FWAFLKMP---GESEIKRNYHKLAKEFHPDKN---PAAGDKFKEISYAYEVLSDPKKRQV 209 F+A L +P +++IKR Y KLA + HPDKN P A +KF +I AYEVL+D +R++ Sbjct: 26 FYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRKI 85 Query: 210 YDLYXXXXXXXXXXXXXFPADEIXXXXXXXXXXXXXSRGCGQGLGPVRGEDTMHPLAVTL 389 YD +D G RG D L VTL Sbjct: 86 YDQRGEEGLKNAGHRDH--SDPFSSFFGGFGFHFDGHNGHSHSQQVPRGSDLTVDLEVTL 143 Query: 390 EDLYAGKTTKLQLSKNVI 443 E+LY G ++ + + I Sbjct: 144 EELYNGNFIEVHVVREKI 161 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKN--PAAGDKFKEISYAYEVLSDPKKRQVYDLY 221 +++IK+ Y KL+ ++HPDKN P+A KF++ + AY+VLSDPKKR +Y+ + Sbjct: 17 DADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQF 67 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 59.3 bits (137), Expect = 2e-09 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPA----AGDKFKEISYAYEVLSDPKKRQVYDLY 221 E ++K+ Y + A +HPDKNP A +KFK++S AYEVLSD +KR +YD Y Sbjct: 17 EEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRDIYDKY 69 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 58.0 bits (134), Expect = 5e-09 Identities = 25/61 (40%), Positives = 38/61 (62%) Frame = +3 Query: 33 TNYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDKFKEISYAYEVLSDPKKRQVY 212 +NY + +I+R Y +LA ++HPDKN + FKE+S AYEVL DP++R+ + Sbjct: 3 SNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEENFKEVSEAYEVLCDPQQRERF 62 Query: 213 D 215 D Sbjct: 63 D 63 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 55.2 bits (127), Expect = 3e-08 Identities = 24/51 (47%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPA--AGDKFKEISYAYEVLSDPKKRQVYDLY 221 + +IK+ + K+A ++HPDKN A +KF+E++ AYEVLSD KR+ YD + Sbjct: 39 DKQIKKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVLSDENKRRQYDQF 89 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 53.2 bits (122), Expect = 1e-07 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 7/55 (12%) Frame = +3 Query: 48 FWAFLKMP---GESEIKRNYHKLAKEFHPDKNP----AAGDKFKEISYAYEVLSD 191 ++ L++P E +IK++Y KLA ++HPDKNP A KFKEIS AYEVLSD Sbjct: 4 YYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 52.8 bits (121), Expect = 2e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 8/76 (10%) Frame = +3 Query: 12 EGKKWLITNYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDK--------FKEIS 167 E KK +Y + K E EIK+ Y K A + HPD++ A D+ FKE++ Sbjct: 151 ELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVN 210 Query: 168 YAYEVLSDPKKRQVYD 215 AY +LSDPKK++ YD Sbjct: 211 EAYSILSDPKKKRRYD 226 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 52.8 bits (121), Expect = 2e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 8/76 (10%) Frame = +3 Query: 12 EGKKWLITNYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDK--------FKEIS 167 E KK +Y + K E EIK+ Y K A + HPD++ A D+ FKE++ Sbjct: 151 ELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVN 210 Query: 168 YAYEVLSDPKKRQVYD 215 AY +LSDPKK++ YD Sbjct: 211 EAYSILSDPKKKRRYD 226 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 51.2 bits (117), Expect = 6e-07 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPAAGDK----FKEISYAYEVLSDPKKRQVYD 215 +S +K+ Y KLA ++HPDKN ++ F+EI AY+VLSDP++R YD Sbjct: 17 DSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERAFYD 67 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 5/56 (8%) Frame = +3 Query: 63 KMPGESEIKRNYHKLAKEFHPDK-----NPAAGDKFKEISYAYEVLSDPKKRQVYD 215 K ESEIKR Y K++ + HPD+ A KF+ +S +Y +LSD +KR +YD Sbjct: 24 KTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRAIYD 79 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 45.2 bits (102), Expect = 4e-05 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = +3 Query: 48 FWAFLKMP---GESEIKRNYHKLAKEFHPDKNPAAGDKFK---EISYAYEVLSDPKKRQV 209 F+ L +P ++EIK + K KEFHPD NP D K ++S AY LS +RQ Sbjct: 9 FYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQ 68 Query: 210 YD 215 YD Sbjct: 69 YD 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 45.2 bits (102), Expect = 4e-05 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = +3 Query: 48 FWAFLKMP---GESEIKRNYHKLAKEFHPDKNPAAGDKFK---EISYAYEVLSDPKKRQV 209 F+ L +P ++EIK + K KEFHPD NP D K ++S AY LS +RQ Sbjct: 70 FYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQ 129 Query: 210 YD 215 YD Sbjct: 130 YD 131 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNP---AAGDKFKEISYAYEVLSDPKKRQVYD 215 E EI + Y K A + HPDKNP A + F ++S A EVL+DPK R ++ Sbjct: 20 EKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLTDPKARAAFN 69 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = +3 Query: 78 SEIKRNYHKLAKEFHPDKNPAAGDKFKEISYAYEVLSDPKK 200 +EI+R Y L+K++HPDK KF I+ AYE +SD K Sbjct: 1262 AEIRRQYRSLSKKYHPDKETGDPRKFMRIAKAYEAVSDFNK 1302 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 41.9 bits (94), Expect = 3e-04 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +3 Query: 36 NYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDK---FKEISYAYEVLSDPKKRQ 206 NY +S+IK Y+KL+ + HPD++ + K F+EI+ AY VL + + R+ Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRK 131 Query: 207 VYD 215 YD Sbjct: 132 QYD 134 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.9 bits (94), Expect = 3e-04 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +3 Query: 36 NYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDK---FKEISYAYEVLSDPKKRQ 206 NY +S+IK Y+KL+ + HPD++ + K F+EI+ AY VL + + R+ Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRK 131 Query: 207 VYD 215 YD Sbjct: 132 QYD 134 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/49 (38%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPA--AGDKFKEISYAYEVLSDPKKRQVYD 215 + EIK Y++L++ +HPD N + A ++F E++ AY LS + R+ YD Sbjct: 64 QREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYD 112 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/49 (38%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPA--AGDKFKEISYAYEVLSDPKKRQVYD 215 + EIK Y++L++ +HPD N + A ++F E++ AY LS + R+ YD Sbjct: 211 QREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYD 259 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPA--AGDKFKEISYAYEVLSDPKKRQVYD 215 ++EI+R Y +++ + HPD+N A KF+++ EVL D KR+ YD Sbjct: 2496 QAEIRRAYRRISLQLHPDRNKEDDAELKFRKLVAVAEVLKDEDKRKRYD 2544 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Frame = +3 Query: 36 NYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKNPAAGDK-----FKEISYAYEVLSDPKK 200 +Y + + + EI + Y KLA ++HPD K F +I+ A EVL+DP+K Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEK 267 Query: 201 RQVYD 215 R YD Sbjct: 268 RAKYD 272 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKN----PAAGDKFKEISYAYEVLSDPKKRQ 206 + EIK+ Y KLA ++HPD++ A F EI AYE+LS K ++ Sbjct: 807 QEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 >SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 926 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +3 Query: 72 GESEIKRNYHKLAKEFHPD--KNPAAGDKFKEISYAYEVL 185 G + + Y KLAK++HPD K+ A G++F I +AY V+ Sbjct: 402 GSVDAREAYLKLAKQYHPDSGKSTADGERFAMIEHAYRVV 441 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 28.3 bits (60), Expect(2) = 0.015 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 153 FKEISYAYEVLSDPKKRQVY 212 F ++ AYEVLSDP+ + +Y Sbjct: 202 FSKVQKAYEVLSDPETKAIY 221 Score = 27.1 bits (57), Expect(2) = 0.015 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 36 NYTRFWAFLKMPGESEIKRNYHKLAKEFHPDKN 134 +Y A K E E+K Y +L +HPDK+ Sbjct: 131 DYYAVLAVRKEANEDELKAAYRRLCVLYHPDKH 163 >SB_23942| Best HMM Match : 5-nucleotidase (HMM E-Value=4) Length = 735 Score = 35.5 bits (78), Expect = 0.029 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -3 Query: 315 HPFQRGYQRNYQKFHQPETLLLGRLPVVL*ARISHTLVFS*DRITLHMRNLFL 157 HPFQRG+ R ++FH P + +L +S V ++ +H R L + Sbjct: 538 HPFQRGWYRRCERFHHPFSTVLNDFRETYLQYVSWKSVMDDKQLDIHFRTLII 590 >SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) Length = 106 Score = 34.7 bits (76), Expect = 0.051 Identities = 12/21 (57%), Positives = 19/21 (90%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNP 137 ES+I++ Y +LA+++HPDKNP Sbjct: 83 ESKIRKAYFRLAQKYHPDKNP 103 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 33.9 bits (74), Expect = 0.090 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 81 EIKRNYHKLAKEFHPDKNPAAGDK---FKEISYAYEVLSDPKKRQVYD 215 +I + K AKE+HPDK D F + A +VL D K R YD Sbjct: 303 QINTEFKKKAKEWHPDKKRNDTDSHEYFARLKKARDVLCDEKMRAKYD 350 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 10/48 (20%) Frame = +3 Query: 84 IKRNYHKLAKEFHPDKNPAAG----------DKFKEISYAYEVLSDPK 197 IKR Y KL E HPDK A G K +EI AYE++ K Sbjct: 91 IKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQK 138 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +3 Query: 75 ESEIKRNYHKLAKE----FHPDKNPAAGDKFKEISYAYEVLSDPKKRQVYD 215 + E+K+ K ++ +HPDKN ++ + I AY L D + R Y+ Sbjct: 148 KDELKKTLKKACRKQLLIWHPDKNGGDAEQARNIIMAYSCLEDDETRARYN 198 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 126 DKNPAAGDKFKEISYAYEVLSDPKKRQVYD 215 D A KF+ I+ AYE L DP++R YD Sbjct: 74 DDKENAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDKNPAAG--DKFKEIS 167 + +I R Y KLA HPDK+ A G + FK +S Sbjct: 156 KDDINRAYKKLAVLIHPDKSVAPGSEEAFKALS 188 >SB_13496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 229 KDYRKAAKEEGFRLMKFLVISLVTSLEWVGVEDVVKALV 345 KD R+ + GFRL KF+ S V +E + VE+ K +V Sbjct: 202 KDLRQTCAQGGFRLTKFVSNSRVV-METILVEEYAKQIV 239 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDK 131 + +IKR Y KLA HPDK Sbjct: 813 DDDIKRQYRKLAVLIHPDK 831 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 75 ESEIKRNYHKLAKEFHPDK 131 + +IKR Y KLA HPDK Sbjct: 11 DDDIKRQYRKLAVLIHPDK 29 >SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) Length = 278 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 342 GPVRGEDTMHPLAVTLEDLYAGKTTKLQLSKNVI 443 GP++ L V+LE+LY G KL+++ V+ Sbjct: 96 GPIQEPAVEKILPVSLEELYIGSVRKLRINHQVL 129 >SB_963| Best HMM Match : CUB (HMM E-Value=1.8e-19) Length = 507 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 362 IFATDWTKALTTSSTPTHSKEVTKEITKNFISRKP 258 I T + T+ TPT + VT IT N ++R+P Sbjct: 134 ISTTQLSSHNATTVTPTQATSVTHVITTNHVTRQP 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,122,858 Number of Sequences: 59808 Number of extensions: 372228 Number of successful extensions: 1068 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -