BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0250 (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 30 0.044 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 30 0.044 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 30 0.059 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 30 0.059 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 30 0.059 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 30 0.059 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 30 0.059 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 30 0.059 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 30 0.059 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 30 0.059 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 30 0.059 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 25 1.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 5.1 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 5.1 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 30.3 bits (65), Expect = 0.044 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 141 AGDKFKEISYAYEVLSDPKKRQVYDLY 221 A +F EI +YE+LSD ++R+ +D Y Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 30.3 bits (65), Expect = 0.044 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 141 AGDKFKEISYAYEVLSDPKKRQVYDLY 221 A +F EI +YE+LSD ++R+ +D Y Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY 26 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.059 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 150 KFKEISYAYEVLSDPKKRQVYDLY 221 +F EI +YE+LSD ++R+ +D Y Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 25.4 bits (53), Expect = 1.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 63 KMPGESEIKRNYHKLAKEFHPD 128 + PG I +NY +L KEF D Sbjct: 114 RKPGSGNIPKNYARLLKEFTRD 135 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 5.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 390 EDLYAGKTTKLQLSKNVICAHCKGVG 467 +D YA + T++ L + C C G+G Sbjct: 674 QDFYANEETRICLPCHQECRGCHGLG 699 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 5.1 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -1 Query: 350 DWTKALTTSSTPTHSKEVT----KEITKNFISRKPSSL 249 DW TSS P H + VT + I + SRK L Sbjct: 416 DWPMPTETSSEPYHIRPVTDLELERIADDMCSRKAPGL 453 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,744 Number of Sequences: 2352 Number of extensions: 13336 Number of successful extensions: 60 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -