Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0244
         (413 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   2.4  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    22   2.4  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    21   7.3  
AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc fi...    21   7.3  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    20   9.6  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 17  FGTRVELWISW 49
           F TR +LWISW
Sbjct: 381 FLTRGDLWISW 391


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 189 GGHCYWP 169
           GG CYWP
Sbjct: 139 GGSCYWP 145


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +1

Query: 25  EGGTLDQLVGLSDDL 69
           EG +  Q VGL DDL
Sbjct: 291 EGVSFGQSVGLKDDL 305


>AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc
           finger domain-Z1 isoform protein.
          Length = 111

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 9/37 (24%), Positives = 18/37 (48%)
 Frame = +2

Query: 260 RHHKQTGRTDRRGSEGQVLRLQRSQRKPTQFREETDR 370
           R+HK         +E Q   +++ + +  + RE +DR
Sbjct: 49  RNHKSIYHRQHSKNEQQRKEMEQMREREREQREHSDR 85


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 20.2 bits (40), Expect = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 204 RFQWDMAKY 230
           +FQWD A+Y
Sbjct: 81  KFQWDPAEY 89


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,509
Number of Sequences: 438
Number of extensions: 2383
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10503195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)