BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0243 (557 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.8 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 6.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.4 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 482 PTSSRTGAPQTRRGRAAHQPS 544 P+SS + +P + AA QPS Sbjct: 521 PSSSTSSSPPAKGAAAAGQPS 541 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.4 bits (43), Expect = 6.4 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 60 VCVKA*VIQLLLSRAHIFLSIVKESVIIREIKMRAVFFG 176 VCV A I+ L +R H S+ K I + K V G Sbjct: 12 VCVGALTIEELKTRLHTEQSVCKTETGIDQQKANDVIEG 50 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 465 LSPHEQVVNELGRVLAFFSRSIEE 394 + H Q+++ L VLA R ++E Sbjct: 362 IDQHSQLIDTLENVLAIVDRLMDE 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,521 Number of Sequences: 438 Number of extensions: 2794 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -