BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0241 (304 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 27 2.4 At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101)... 25 7.4 At5g64190.1 68418.m08060 expressed protein 25 9.7 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 96 SPFSLPSSLDQSFPKNYPPPQNEKTIYKLHFSSLS*P 206 +P +PS S NYPPPQ+ + + SS+ P Sbjct: 174 NPMDIPSDFS-SATTNYPPPQSSEANFYPPLSSIGYP 209 >At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101) family protein contains Pfam profile PF05743: Tumour susceptibility gene 101 protein (TSG101); similar to Tumor susceptibility gene 101 protein (Swiss-Prot:Q99816) [Homo sapiens] Length = 398 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 96 SPFSLPSSLDQSFPKNYPP 152 S S P S DQS P+ +PP Sbjct: 177 SSLSRPPSADQSLPRPFPP 195 >At5g64190.1 68418.m08060 expressed protein Length = 502 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 159 FEVEGSF*GSFDPTN 115 FEVE S GSFDP N Sbjct: 346 FEVERSIEGSFDPPN 360 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,390,333 Number of Sequences: 28952 Number of extensions: 90136 Number of successful extensions: 231 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 231 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -