BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0237 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 46 2e-05 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 46 3e-05 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 44 6e-05 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 44 6e-05 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 44 8e-05 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 43 1e-04 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 43 1e-04 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 43 1e-04 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 43 1e-04 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 43 2e-04 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 43 2e-04 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 43 2e-04 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 43 2e-04 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 43 2e-04 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 42 3e-04 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 42 3e-04 SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) 42 3e-04 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 42 4e-04 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 42 4e-04 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 42 4e-04 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 41 6e-04 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 41 8e-04 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 41 8e-04 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 40 0.001 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 40 0.001 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 40 0.001 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 40 0.001 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 40 0.001 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) 40 0.002 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 40 0.002 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 36 0.017 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 36 0.017 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 36 0.022 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 36 0.022 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 35 0.038 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 35 0.038 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 35 0.050 SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) 34 0.067 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.067 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 34 0.088 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 33 0.20 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 32 0.27 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 32 0.27 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 32 0.27 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 32 0.27 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_34294| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 31 0.62 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 31 0.62 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 31 0.62 SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 31 0.82 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 30 1.1 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 30 1.1 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 30 1.1 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 30 1.4 SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) 30 1.4 SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) 30 1.4 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 30 1.4 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 30 1.4 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 30 1.4 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 29 1.9 SB_253| Best HMM Match : GRP (HMM E-Value=0.61) 29 1.9 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 29 2.5 SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05) 29 2.5 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 29 2.5 SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) 29 3.3 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 29 3.3 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 3.3 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 29 3.3 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 29 3.3 SB_34523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) 28 4.4 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 28 5.8 SB_20793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_9354| Best HMM Match : Endonuclease_7 (HMM E-Value=0.18) 28 5.8 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 28 5.8 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 27 7.6 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 27 7.6 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + L +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 45.6 bits (103), Expect = 3e-05 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQGL 407 IC +C + +P+LL CLHSFC SC++GL Sbjct: 61 ICRVCNQRFNKPKLLHCLHSFCQSCIEGL 89 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 44.4 bits (100), Expect = 6e-05 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 44.4 bits (100), Expect = 6e-05 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 70 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 44.4 bits (100), Expect = 6e-05 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 44.0 bits (99), Expect = 8e-05 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C +C + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 132 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGKGKLVCPLCKSEFQISP 185 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C +C + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C +C + +PR+L CLHSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQGLHQE 416 ICG+CR+ +PR+ CLHSFC C+ L E Sbjct: 404 ICGVCRETYTDPRVAPCLHSFCKECVTKLVTE 435 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACEL 431 E C IC + +PR+L CLHSFC CL+ L H EG +L Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKL 52 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACEL 431 E C IC + +PR+L CLHSFC CL+ L H EG +L Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKL 52 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 K + E C IC + +PRLL CLH+FC CL+ L Sbjct: 7 KQLEDEVTCAICIEHFTDPRLLPCLHTFCRHCLEDL 42 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/63 (34%), Positives = 34/63 (53%) Frame = +3 Query: 228 NSPLRTRPASQSLSIAPRTSAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 NSP+ P ++ ++ D+KD+ +++ C IC + LVEP +L C H FC C Sbjct: 6 NSPVPFSPGKALITGLVDSTQQDEKDI-EDFTCPICLQLLVEPVVLPCEHEFCKMCFTQN 64 Query: 408 HQE 416 QE Sbjct: 65 VQE 67 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACEL 431 E C IC + +PR+L CLHSFC CL+ L H EG +L Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKL 51 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 64 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 C IC + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 15 CSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISP 65 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 + KE C IC + +PR+L CLH+FC CL GL Sbjct: 10 LQKEVECPICLERFKDPRVLPCLHTFCYECLVGL 43 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 + KE C IC + +PR+L CLH+FC CL GL Sbjct: 10 LQKEVECPICLERFKDPRVLPCLHTFCYECLVGL 43 >SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) Length = 662 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = +3 Query: 321 ICGICRKELV--EPRLLGCLHSFCTSCLQ 401 ICGICRK P+LL CLHSFC CL+ Sbjct: 21 ICGICRKSSATSNPKLLPCLHSFCFGCLE 49 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACELWSEVDRESIQQDP 470 E C +C + +PR+L C HSFC CL+ L H EG +L + + Q P Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSEGKGKLVCPLCKAEFQISP 65 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 41.5 bits (93), Expect = 4e-04 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 294 DKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEG 419 +K +K+ C +C ++ +PR+L CLH++C CL+ L H +G Sbjct: 6 EKVGDVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQG 49 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 41.5 bits (93), Expect = 4e-04 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCL 398 +CGIC++ P++L CLHSFC +CL Sbjct: 16 VCGICQETYNNPKVLPCLHSFCQNCL 41 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACEL 431 E C IC + +PR+L C HSFC CL+ L H EG +L Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKL 52 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 315 EWICGICRKELVEPRLLGCLHSFCTSCLQGL--HQEGACEL 431 E C IC + +PR+L C HSFC CL+ L H EG +L Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKL 52 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 41.1 bits (92), Expect = 6e-04 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 303 DVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQE 416 ++ K C +C + + P+LL CLHSFC +CL+ L E Sbjct: 13 ELSKHLNCSLCHRLIRGPKLLPCLHSFCLACLEDLVTE 50 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 294 DKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG-ACELWSEVDRESIQ 461 +K +K+ C +C ++ +PR+L CLH++C CL+ L + C + RE I+ Sbjct: 6 EKVGDVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIE 62 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 40.7 bits (91), Expect = 8e-04 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQ 413 V +E C +C ++ EP++L C H+FC CL+ Q Sbjct: 16 VREELTCSVCLEQFREPKMLPCFHTFCKECLEKTKQ 51 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 40.7 bits (91), Expect = 8e-04 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = +3 Query: 294 DKK--DVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLH--QEGA 422 DKK D+ +E C C +PRLL CLHS C CL+ + QEGA Sbjct: 9 DKKLEDLPEEIWCRYCNGIFEDPRLLPCLHSLCKKCLKDIEQAQEGA 55 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQG-LHQEG 419 + + ++ +C +C E P LL C HSFC C+Q LHQ G Sbjct: 12 RGLAEQLMCPVCLGEYKNPMLLRCYHSFCLRCVQELLHQSG 52 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 KDV + C +C ++ +PR+L CLH++C CL+ L Sbjct: 10 KDV-SDVTCSLCLEQYQDPRVLACLHTYCRHCLESL 44 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGLHQEG-ACELWSEVDRESIQ 461 C +C ++ +PR+L CLH++C CL+ L + C + RE I+ Sbjct: 26 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIE 72 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 KDV + C +C ++ +PR+L CLH++C CL+ L Sbjct: 10 KDV-SDVTCSLCLEQYQDPRVLACLHTYCRHCLESL 44 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 282 TSAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 TS +KD K+ C +C +PRLL CLH++C CL+ L Sbjct: 3 TSTPQEKDE-KDVTCLLCLDIFTDPRLLPCLHTYCKKCLEDL 43 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGL 407 C +C + PRLL CLH+FC CL+ L Sbjct: 145 CPLCHEMFANPRLLPCLHTFCKRCLENL 172 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG-ACELWSEVDRESIQ 461 KDV + C +C + +PR+L CLH++C CL+ L + C + RE I+ Sbjct: 10 KDV-SDVTCSLCLGQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIE 63 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGLH 410 C C K EP++L CLH+FC CL G H Sbjct: 16 CRACHKVFTEPKILDCLHTFCQKCL-GTH 43 >SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) Length = 96 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQGLHQEGACELWSEVDRESI 458 +C IC +E +P+ L C+H+ C CL+ + + A + +D + + Sbjct: 21 VCPICEEEYDDPKRLPCMHTICLGCLESMVPKNALIMKCPIDEQEL 66 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +3 Query: 303 DVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 D+ ++ CGIC L + R+L CLH++C C++ + Sbjct: 138 DIRQQLACGICHALLRDARVLPCLHTYCRRCIEDI 172 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 38.7 bits (86), Expect = 0.003 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 309 MKEWICGICRKELVEPRLLGCLHSFCTSCLQGL 407 + E +C IC E EP+ L C+H C CL+ + Sbjct: 16 LDELLCPICLDEFKEPKTLSCMHDLCRKCLEDM 48 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 37.9 bits (84), Expect = 0.005 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQ 401 C +C + L EP++L C H +C CLQ Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQ 39 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 37.5 bits (83), Expect = 0.007 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C +C K EP++L C H+FC CL Sbjct: 98 CSLCHKTPSEPKILKCFHTFCNECL 122 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 291 YDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSC 395 Y V E++C CRK + P + GC H CT C Sbjct: 7 YFDDPVPSEFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 300 KDVMKEWICGICRKELVE----PRLLGCLHSFCTSCLQGL 407 K ++ E CG+C++E E P+LL C H+ C +C+ L Sbjct: 212 KVIIDECTCGVCQEEFNEKTRVPKLLHCSHTLCKACVSAL 251 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQG 404 +C ICR L EP + C HS+C++C+ G Sbjct: 17 LCCICRDVLEEPLMAPCEHSYCSACVLG 44 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 300 KDVMKEWICGICRKELVE----PRLLGCLHSFCTSCLQGL 407 K ++ E CG+C++E E P+LL C H+ C +C+ L Sbjct: 315 KVIIDECTCGVCQEEFNEKTRVPKLLHCSHTLCKACVSAL 354 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCL-QGLHQEGACE 428 +C C P++L CLH+FC+ CL + LH++ CE Sbjct: 14 VCPKCMNAYENPKVLPCLHTFCSQCLSEELHRD--CE 48 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 35.9 bits (79), Expect = 0.022 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQ 401 C C + +PR+L CLHS C +CL+ Sbjct: 19 CPACSNVIKDPRILPCLHSICKTCLE 44 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLGCLHSFCTSCL-QGLHQEGACELWSE 440 V ++ CGIC L +P + C H FC+ CL + + G C L E Sbjct: 51 VEDDFKCGICFGVLEDPLVTTCGHVFCSQCLVHWIAENGTCPLTCE 96 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 35.1 bits (77), Expect = 0.038 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 255 SQSLSIAPRTSAYDKKDVMKEWI-CGICRKELVEPRLL-GCLHSFCTSCL 398 S++L ++ ++S + + + + C +C + +PR L CLHSFC CL Sbjct: 44 SKTLRVSKQSSLKKLQRALNDELRCSVCYEVFSDPRTLTACLHSFCKECL 93 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 35.1 bits (77), Expect = 0.038 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQ 401 C IC + P++L CLH++C+ C++ Sbjct: 659 CPICSRPFKSPKILPCLHTYCSDCVK 684 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 34.7 bits (76), Expect = 0.050 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQG-LHQEGACEL 431 +++ E+ C +C++ + L C HSFC CLQ L + C + Sbjct: 363 EEMEDEFSCIVCQELFIRATTLTCSHSFCEYCLQSWLRKRNTCPI 407 >SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) Length = 169 Score = 34.3 bits (75), Expect = 0.067 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 324 CGICRKELVEPRLLG-CLHSFCTSCL 398 CG+C L++P + CLH+FC SC+ Sbjct: 64 CGLCEGYLIKPTTITECLHTFCKSCI 89 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 34.3 bits (75), Expect = 0.067 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 312 KEWICGICRKELVEPRLL-GCLHSFCTSCLQGLHQEGACELWSEVDRES 455 +E C +C +EL EP+ L C H+ C CL + G E+ R S Sbjct: 13 EELTCPVCLEELKEPKCLTSCAHNVCKPCLDRMTFNGEKEIRCPTCRRS 61 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 33.9 bits (74), Expect = 0.088 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPRLLG-CLHSFCTSCLQGLHQEGACE 428 +++ E C IC ++ EP+ L C H+ C CL G+ ++ E Sbjct: 17 ENIQDEISCPICYEDFEEPKCLPKCAHNICRECLLGIIEKAQLE 60 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 33.9 bits (74), Expect = 0.088 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 315 EWICGICRKELVEPRLL-GCLHSFCTSCLQGL 407 E C +C ++ +EP+ L C H+ C CL+G+ Sbjct: 20 ECSCPVCLEDFLEPKSLPNCAHNVCRKCLEGM 51 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPR-LLGCLHSFCTSCL 398 KD+ IC +C LV+ ++ CLHSFC SC+ Sbjct: 1358 KDLNPHIICVLCGGYLVDATTIVECLHSFCRSCI 1391 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 33.1 bits (72), Expect = 0.15 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C C PR+ CLHSFC CL Sbjct: 16 CRQCSNVFKNPRITPCLHSFCAECL 40 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 32.7 bits (71), Expect = 0.20 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C IC L +P + C H FCT CL Sbjct: 65 CPICLDPLDDPSITRCAHVFCTGCL 89 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 32.3 bits (70), Expect = 0.27 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSC-LQGLHQEGAC 425 C +CRK P + CLH FC +C LQ + C Sbjct: 245 CIMCRKTFKNPVVTKCLHYFCEACALQHYKKNSKC 279 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 32.3 bits (70), Expect = 0.27 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGLHQEGACELWSEVDR 449 C C++ + +P LL CL S C SC Q Q+ +W+ + R Sbjct: 119 CPSCKETMNDPVLLPCLDSICRSCCQKSAQKHG-NMWNVLCR 159 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 32.3 bits (70), Expect = 0.27 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 297 KKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQ 401 K +++ C C+ P+ L CLH+FC CL+ Sbjct: 9 KIGLIERLTCSACKGFYKNPKRLPCLHAFCCHCLK 43 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQ 401 +CGIC + L L C HSFC CL+ Sbjct: 17 LCGICAEVLERAVLTPCGHSFCGVCLE 43 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 32.3 bits (70), Expect = 0.27 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = +3 Query: 300 KDVMKEWI-CGICRKELVEPRLL-GCLHSFCTSCLQGLHQEGACELWSEVDR-ESI 458 K V +E I C +C + EP +L C HS C CLQ + + L V R ES+ Sbjct: 14 KSVQREEISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTKRNPPSLLCPVCRSESV 69 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 31.9 bits (69), Expect = 0.36 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQ 401 +C IC + +P L C HS+C C+Q Sbjct: 29 MCAICHIVVKDPILTSCGHSYCKCCIQ 55 >SB_34294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 520 SLSYPDPAEPKPDPDSAGSCWIDSLSTSLH 431 +LSY D A P D D+ WI+ + TSLH Sbjct: 154 ALSYEDNATPYKDHDTPIKTWINLIKTSLH 183 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 31.5 bits (68), Expect = 0.47 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C +CR+ +P + C H+FC +C+ Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQACI 218 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 297 KKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQE 416 ++++ K C C++ + P LL CL S C SC Q Q+ Sbjct: 18 RENLTKFITCPSCKETMNGPVLLPCLDSICRSCCQKTAQK 57 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 297 KKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQE 416 ++++ K C C++ + P LL CL S C SC Q Q+ Sbjct: 18 RENLTKFITCPSCKETMNGPVLLPCLDSICRSCCQKTAQK 57 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 312 KEWICGICRKELVEP-RLLGCLHSFCTSCLQGLHQ 413 +E+ C IC+ +P ++ C H FC SCLQ L + Sbjct: 22 EEYECPICQLAFRDPIQIEECGHRFCQSCLQELRR 56 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 255 SQSLSIAPRTSAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCL 398 S++L S + + ++ C +C L+EP C HSFC CL Sbjct: 307 SENLENGDIRSPASNTEQLDDFECKLCFNLLLEPVTSLCGHSFCRDCL 354 Score = 29.9 bits (64), Expect = 1.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQ 401 CG+C V+P + C H++C +C++ Sbjct: 22 CGLCGDFYVDPVTILCGHTYCLACIK 47 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 31.1 bits (67), Expect = 0.62 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 213 SISAGNSPLRTRPASQSLSIAPRTSAYDKKDVMKEWICGICRKELVEPR---LLGCLHSF 383 S+S N L+ Q+ I D V KE CGIC + E + L+ C HSF Sbjct: 278 SVSEANEKLQQDLVKQA-KIRSGIDTRDWFMVSKE--CGICFGDFRENKMTALMSCGHSF 334 Query: 384 CTSC 395 CT C Sbjct: 335 CTEC 338 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 30.7 bits (66), Expect = 0.82 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 157 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGGKHPACPICQETL 216 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 217 ADPNDLQRAP 226 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 30.7 bits (66), Expect = 0.82 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 153 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETL 212 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 213 ADPNDLQRAP 222 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 30.7 bits (66), Expect = 0.82 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 61 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETL 120 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 121 ADPNDLQRAP 130 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 30.7 bits (66), Expect = 0.82 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 159 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETL 218 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 219 ADPNDLQRAP 228 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 30.7 bits (66), Expect = 0.82 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 304 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETL 363 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 364 ADPNDLQRAP 373 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPR-LLGCLHSFCTSCL 398 K++ IC +C LV+ ++ CLHSFC C+ Sbjct: 40 KELNPHIICVLCGGYLVDATTIIECLHSFCRCCI 73 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 30.3 bits (65), Expect = 1.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 354 PRLLGCLHSFCTSCLQGLHQ 413 PR+L C H+FCT C+ + + Sbjct: 346 PRILDCSHTFCTECIMKIKE 365 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 300 KDVMKEWICGICRKELVEPR-LLGCLHSFCTSCL 398 K++ IC +C LV+ ++ CLHSFC C+ Sbjct: 8 KELNPHIICVLCGGYLVDATTIIECLHSFCRCCI 41 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 103 TERFDFFETKKEEFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETL 162 Query: 441 VDRESIQQDP 470 D +Q+ P Sbjct: 163 ADPNDLQRAP 172 >SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 336 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/39 (28%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 303 DVMKEWICGICRKELVEPRLL-GCLHSFCTSCLQGLHQE 416 D ++IC +C ++ P ++ C HS C+SC + ++++ Sbjct: 49 DAPDDFICNVCGTVMLVPVVMPNCGHSCCSSCAERVNRK 87 >SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 349 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/39 (28%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 303 DVMKEWICGICRKELVEPRLL-GCLHSFCTSCLQGLHQE 416 D ++IC +C ++ P ++ C HS C+SC + ++++ Sbjct: 49 DAPDDFICNVCGTVMLVPVVMPNCGHSCCSSCAERVNRK 87 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C IC++ L +P C H FC C+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C IC++ L +P C H FC C+ Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCI 58 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C IC++ L +P C H FC C+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCL 398 C IC++ L +P C H FC C+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG----ACELWSE-- 440 T +D + KE + C IC L +P C HS C+ C + + G AC + E Sbjct: 103 TERFDFFETKKEEFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETL 162 Query: 441 VDRESIQQDP 470 D +Q P Sbjct: 163 ADPNDLQHAP 172 >SB_253| Best HMM Match : GRP (HMM E-Value=0.61) Length = 356 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 331 YVGK---NWWNRGCWAASTASAPAVFRVCIRRVL 423 YVGK +WW G W A A F +R++L Sbjct: 95 YVGKGNGDWWKEGAWTCHMGPAGAAFAGPVRQLL 128 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 531 NVSSHSRIRIRRNPSLILIRQDLVGLTLYRLR 436 +VS H +R + P I Q L G T+YR+R Sbjct: 3258 SVSGHVSVRSKSGPVQSYILQGLAGFTVYRIR 3289 >SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05) Length = 1442 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 264 LSIAPRTSAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSC 395 L++ TS D+K MK+ C + L E + + L + T C Sbjct: 1126 LTVTEETSELDRKARMKQLTCYLAEYTLFEQKFVEALMEYATRC 1169 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG 419 T +D + KE + C IC L +P C HS C+ C + + G Sbjct: 301 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELG 347 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 282 TSAYDKKDVMKE-WICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG 419 T +D + KE + C IC L +P C HS C+ C + + G Sbjct: 627 TERFDFFETKKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELG 673 >SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) Length = 233 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 285 SAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQ 401 +A+ +K V + + C C+ ++ P CLH+ C CLQ Sbjct: 93 TAFHQK-VEELFACVCCQDLVLYPVTTKCLHNICKGCLQ 130 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 324 CGICRKELVEPRLL-GCLHSFCTSCL 398 C IC + + P L GC H+FC C+ Sbjct: 678 CPICLETITYPETLQGCGHTFCRPCI 703 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQ 401 C IC+ L EP C H C SC + Sbjct: 34 CTICKHVLQEPLQTTCGHRICESCFE 59 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 324 CGICRKELVEPRLL-GCLHSFCTSCL 398 C IC + + P L GC H+FC C+ Sbjct: 753 CPICLETITYPETLQGCGHTFCRPCI 778 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 324 CGICRKELVEPRLLGCLHSFCTSCLQGL 407 C +C ++ P L C H FC C++G+ Sbjct: 71 CPVCLQQASYPVRLPCGHMFCFLCIKGV 98 >SB_34523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -2 Query: 423 KHPPDADPEDSWCRSCGG-SPAASVPPILSYISRRSTPS 310 K PDA P WC + P S PPI SR P+ Sbjct: 140 KSLPDATPGAVWCENYAVLPPIESAPPITGLYSRHLQPT 178 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 312 KEWICGICRKELVEPRLLGCLHSFCTSCLQGLHQEG 419 +E+ C IC L +P C HS C+ C + G Sbjct: 21 EEFHCAICLDVLEKPLSSKCQHSCCSDCWESAFDLG 56 >SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) Length = 413 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLGCLHSF 383 V E C +C + +PR+L CL SF Sbjct: 70 VEDEVTCSLCIEHFTDPRVLHCLRSF 95 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 321 ICGICRKELVEPRLLGCLHSFCTSCLQ 401 +C IC L C HSFC SCL+ Sbjct: 17 LCNICVGVLENAITTICGHSFCESCLE 43 >SB_20793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -1 Query: 523 KSLSYPDPAEPKPDPDSAGSCWIDSLSTSLHNSQAPS*CRP*RQLVQKLWRQPSSLGSTN 344 K P P +P PD ++ W S+S + S CR R+L+ + + + LG T Sbjct: 45 KKKRIPTP-KPYPDRHTSRGVWSYSMSAGVFYSWQGHPCRTGRKLITETRSRANLLGKTV 103 Query: 343 SFLH 332 + H Sbjct: 104 AASH 107 >SB_9354| Best HMM Match : Endonuclease_7 (HMM E-Value=0.18) Length = 386 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +3 Query: 285 SAYDKKDVMKEWICGICRKELVEPRLLGCLHSFCTSCLQG-LHQEGACELWSEVDRESIQ 461 S YD+ K C IC KE + H T +G HQE C L +D E I+ Sbjct: 183 SKYDEDQFQKAQECHICNKEYTKKDTRVRDHCHITGKYRGSAHQE--CNLKLRIDPEEIK 240 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 306 VMKEWICGICRKELVEPRLLG-CLHSFCTSCLQGLHQE 416 + +E C IC + P+ L C H+ C SCL+ + E Sbjct: 16 LQEEICCPICTEIFETPKCLPVCAHNVCLSCLKKMKIE 53 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 309 MKEWICGICRKELVEPRLLGCLHSFCTSCL-QGLHQEGACEL 431 ++E+ C +C + P C H FC +CL + L C + Sbjct: 374 VEEFECTLCCRLFYNPVTTPCGHVFCRACLNRSLDHRPGCPI 415 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +3 Query: 324 CGICRKELVE----PRLLGCLHSFCTSCLQGLHQ 413 C IC E + P L C H+ C +CL LH+ Sbjct: 14 CPICYHEFEDRQRGPISLACGHTICKACLSQLHK 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,729,456 Number of Sequences: 59808 Number of extensions: 383222 Number of successful extensions: 1446 Number of sequences better than 10.0: 109 Number of HSP's better than 10.0 without gapping: 1361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1442 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -