BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0233 (505 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_56973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 >SB_18022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 226 CTGEFQKFVCYNIGKFSDIFVAKMISIFNAIFLIST 333 CTG+F + +N+ + K I++FN I L ++ Sbjct: 34 CTGQFSDYDVFNVAAILQMGSVKRIAVFNQIQLFAS 69 >SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 91 NFYVLYHS*ISYLHIVNIVLYK 26 NF VL H+ +SYLHI ++ Y+ Sbjct: 236 NFEVLRHNFVSYLHIWQLIPYR 257 >SB_56973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 226 TKQLKCGNRYIGTYCSLKTTLEQNLTASR 140 TKQ +CG R CS++ T E T R Sbjct: 254 TKQCRCGKREKNVQCSMEFTCEAKCTNMR 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,018,770 Number of Sequences: 59808 Number of extensions: 276388 Number of successful extensions: 482 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -