BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0233 (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 26 0.63 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 26 0.63 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 26 0.63 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 26 0.63 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 3.4 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 4.5 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 4.5 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 4.5 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 4.5 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 5.9 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 7.8 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 7.8 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 25 LFIFCSIFTFSFYTPALDYYLNHP 48 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 25 LFIFCSIFTFSFYTPALDYYLNHP 48 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 26.2 bits (55), Expect = 0.63 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 IFMYYTIVEFRIYTLSTSYYINKP 19 +F++ +I F YT + YY+N P Sbjct: 36 LFIFCSIFTFSFYTPALDYYLNHP 59 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 3.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 256 YNIGKFSDIFVAKMISIFNAIFLISTFI 339 YN K + + MIS+FN F S FI Sbjct: 347 YNFAKADYVKLNDMISMFNNSFHCSNFI 374 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 247 FVCYNIGKFSDIFVAKMISIFNAIFLISTFIYETFIYHA 363 F Y G F + ++ SI+N +L T+ TF+Y++ Sbjct: 82 FDYYKTGAFLE--KGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 247 FVCYNIGKFSDIFVAKMISIFNAIFLISTFIYETFIYHA 363 F Y G F + ++ SI+N +L T+ TF+Y++ Sbjct: 82 FDYYKTGAFLE--KGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 247 FVCYNIGKFSDIFVAKMISIFNAIFLISTFIYETFIYHA 363 F Y G F + ++ SI+N +L T+ TF+Y++ Sbjct: 82 FDYYKTGAFLE--KGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 247 FVCYNIGKFSDIFVAKMISIFNAIFLISTFIYETFIYHA 363 F Y G F + ++ SI+N +L T+ TF+Y++ Sbjct: 82 FDYYKTGAFLE--KGELFSIYNEQYLRQTYAVFTFLYNS 118 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 332 VDIKNIALKIEIILATKISLNLP 264 V + NI K EII ATK+ +LP Sbjct: 513 VVLANIGSKSEIIDATKLDNSLP 535 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 22.6 bits (46), Expect = 7.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 18 RVYLYNTMLTMCRYEIQLWY 77 R L NT ++C E+Q W+ Sbjct: 151 RELLLNTQSSVCTPEVQQWF 170 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 22.6 bits (46), Expect = 7.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 64 FNYGIVHKNFGRLKVAI 114 F YG NF RLKVA+ Sbjct: 209 FRYGKDLSNFSRLKVAL 225 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 499,507 Number of Sequences: 2352 Number of extensions: 11378 Number of successful extensions: 64 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -