BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0231 (540 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 3.5 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 6.1 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 3.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 504 RSSWNVVYDMRVSRLRFEGLGSPLSVGVW 418 RSS +V M + + F GL S L++G W Sbjct: 305 RSSQSVAEVMDRNGVLFFGLLSDLAIGCW 333 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 97 VCASDLLCSRKRPSEFDYRNFDVTCERNKGL 189 VC L + E ++ FD+ CE ++GL Sbjct: 91 VCGIYFLAEPDQKIEINFITFDIPCE-HRGL 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,804 Number of Sequences: 438 Number of extensions: 2421 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -