BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0229 (446 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 26 0.70 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 4.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 8.6 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.8 bits (54), Expect = 0.70 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +3 Query: 48 TLPGTNQGICKPLSRRSSAPVTMPANSSASRSVAPMLFRTNWKSPAHSWSRPTAP 212 T P C PLS SSA + A S +P +N + PA S P P Sbjct: 229 TAPAIPVSSCSPLSTASSASCSSSAAGSLC-PTSPPASVSNGEQPASSVGDPANP 282 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 4.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 140 ERRANALQNELEESRTLLEQADRARRQAEQEL 235 E L+ ELE SRT+L + + + + +L Sbjct: 778 ETEETTLREELEHSRTILAKLQKGIEEEQAKL 809 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 8.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 146 RANALQNELEESRTLLE 196 R AL +ELEESR +L+ Sbjct: 3256 RIAALSDELEESRHILQ 3272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.125 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 254,545 Number of Sequences: 2352 Number of extensions: 3145 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -