BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0222 (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 6.8 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 9.0 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 6.8 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -1 Query: 343 NMPRKMSALINIWPSI*VFIP 281 ++P+ S I ++PS+ V++P Sbjct: 354 DLPKNRSPAIEVYPSLLVYLP 374 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 306 QILIKALILRGIFLCHPVTSLSLVPFSAHIS 398 +I+I AL + GIF+ P+ + FSA ++ Sbjct: 237 KIVIFALTIAGIFISLPIFFFASPQFSASMN 267 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,786 Number of Sequences: 2352 Number of extensions: 8258 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -