BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0222 (562 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82075-2|CAB60333.1| 328|Caenorhabditis elegans Hypothetical pr... 28 5.3 Z83218-3|CAB05688.1| 330|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z82075-2|CAB60333.1| 328|Caenorhabditis elegans Hypothetical protein W07A8.5 protein. Length = 328 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +1 Query: 34 VRNMRVFV*CVTRCILPRXGSCKINYTGSWIEVRSLAEVASEKRTVNSFNS 186 V + + + C+T ++P C +N+ S +E ++ + A +K V F + Sbjct: 130 VYSFGILIFCLTLLLIPYFSDCSVNFLASSLEFQT--DCAPDKHPVTRFTN 178 >Z83218-3|CAB05688.1| 330|Caenorhabditis elegans Hypothetical protein C31A11.6 protein. Length = 330 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +1 Query: 49 VFV*CVTRCILPRXGSCKINYTGSWIEVRSLAEVASEKRTVNSFNSV 189 + + C T ++PR C +N+ S + L A E+ V F ++ Sbjct: 135 ILILCFTLLLIPRLSYCPVNFLASTLVF--LTACAPERHPVTKFTNI 179 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,138,945 Number of Sequences: 27780 Number of extensions: 198920 Number of successful extensions: 404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1155524042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -