BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0222 (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 28 4.9 At2g26530.1 68415.m03183 expressed protein 27 6.5 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 108 IDFTTTXPWQYTSSYALNKYPHISHTPN 25 IDFT + W S+ H+S+TPN Sbjct: 161 IDFTKSNEWTGAKSFNRKSLHHLSNTPN 188 >At2g26530.1 68415.m03183 expressed protein Length = 317 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 94 SCKINYTGSW-IEVRSLAEVASEKRTVNSFNSVQTNTSLINEADDLNFISTR 246 SCK + + W ++ L ASE R ++ +SV+T TSL + +D S+R Sbjct: 226 SCKSSSSKKWRLKDFLLFRSASEGRARHNKDSVKTFTSLFRKQEDTKNSSSR 277 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,100,143 Number of Sequences: 28952 Number of extensions: 172361 Number of successful extensions: 337 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -