BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0219 (545 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38920.1 68418.m04707 hypothetical protein 27 6.2 At4g00060.1 68417.m00006 nucleotidyltransferase family protein c... 27 8.2 >At5g38920.1 68418.m04707 hypothetical protein Length = 192 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 475 VSWN*WVSRSDLTLVMVMFDAPDAWMSLKVA 383 + W W +R+DL FDAPD + ++ A Sbjct: 24 ILWRLWKNRNDLVFKGKQFDAPDMELGMQNA 54 >At4g00060.1 68417.m00006 nucleotidyltransferase family protein contains Pfam profile: PF01909 nucleotidyltransferase domain Length = 839 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 158 RHEFMHSYFFNRLKFENKKGAQCFLLFFNSRLSVR-CVQP 42 RH M +F + + +E +GA+ L + N L+VR +QP Sbjct: 379 RHWGMRGWFHDGVNWEEPRGAEIVLPWRNKSLAVRPIIQP 418 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,510,940 Number of Sequences: 28952 Number of extensions: 231433 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -