BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0212 (561 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0987 - 10016203-10017165,10017346-10018180,10019532-10020379 27 7.7 07_01_0648 + 4866116-4866784 27 7.7 03_05_0858 + 28309266-28311143 27 7.7 >12_01_0987 - 10016203-10017165,10017346-10018180,10019532-10020379 Length = 881 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 370 QEAFRLRHSKDNINNKFMFHHL----DLHTSDRRYKQASVMVDAA 492 Q FR + N +F FHHL DLH + Y+ V+AA Sbjct: 804 QIRFRAEEMESNAGFEFSFHHLSSLEDLHATISCYRATRSSVEAA 848 >07_01_0648 + 4866116-4866784 Length = 222 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 327 CFLTVHINMIVAIESMMPRIAVIRDPVRVEAQQQHF 220 CFL VH+N ++ E + R+ + D VE +++F Sbjct: 139 CFLWVHVNEVILNEYLKHRVDDMVDAGLVEEIEEYF 174 >03_05_0858 + 28309266-28311143 Length = 625 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 439 LHTSDRRYKQASVMVDAAVGGAGYR 513 +H YKQAS ++ GG GYR Sbjct: 573 VHLGSNAYKQASTLLALFAGGDGYR 597 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,290,942 Number of Sequences: 37544 Number of extensions: 230558 Number of successful extensions: 628 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -