BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0211 (470 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 5.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.7 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.0 bits (42), Expect = 5.7 Identities = 17/83 (20%), Positives = 35/83 (42%) Frame = -3 Query: 387 KTSHANDITMSTIKDIDTNSTDVLLKSLGMIAKDLPLIIAMVTLVPLSMRRAISSPFHLY 208 KT + + + +K + N+TD+ +KSL + + + + + ++ L Sbjct: 96 KTKISFNFSQGPVKIMLQNATDLFIKSLESLKPGNQSTPGIKLSINIILSDPNTNKLKLN 155 Query: 207 VNTALILRPLSVDSFILSRSGAS 139 N + L L DS + S A+ Sbjct: 156 TNESYELTVLKSDSLAVRLSAAN 178 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 183 DVI*VPCSRTSGREKR*RVSLTTA 254 D + V C+R GREK+ V L +A Sbjct: 103 DKVTVFCNRDLGREKQFIVKLPSA 126 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 183 DVI*VPCSRTSGREKR*RVSLTTA 254 D + V C+R GREK+ V L +A Sbjct: 103 DKVTVFCNRDLGREKQFIVKLPSA 126 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 341 ISFIVLMVISLAWLVFYYIQRFRYIHAKDRLSKRLC 448 I F +LMVI ++ + F I K +L LC Sbjct: 1289 IFFALLMVIQFFAMMIHRFGTFSQIITKTQLDFDLC 1324 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 341 ISFIVLMVISLAWLVFYYIQRFRYIHAKDRLSKRLC 448 I F +LMVI ++ + F I K +L LC Sbjct: 1289 IFFALLMVIQFFAMMIHRFGTFSQIITKTQLDFDLC 1324 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 183 DVI*VPCSRTSGREKR*RVSLTTA 254 D + V C+R GREK+ V L +A Sbjct: 103 DKVTVFCNRDLGREKQFIVKLPSA 126 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 183 DVI*VPCSRTSGREKR*RVSLTTA 254 D + V C+R GREK+ V L +A Sbjct: 103 DKVTVFCNRDLGREKQFIVKLPSA 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,932 Number of Sequences: 336 Number of extensions: 2114 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -