BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0208 (570 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 4.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 4.9 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.6 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 4.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 235 EQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 EQKS +KN ++ T + + +E + PKI L+ ++ + N Sbjct: 268 EQKS-YKNEREYRKYGKTSKERSRDRMERERSKEPKIISSLSNKTIHNNNN 317 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 122 HIANPNIRERTHKPTTVTKLNRSV*LVSIDR 30 H+ N R H+ V ++NR + IDR Sbjct: 362 HLPQSNKMNRMHRMNRVNRVNRMDRMDRIDR 392 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 195 LDFNS--EFLNSDFCSPLIIAHRGASGYVPEHTLGS 296 L +NS E + + + +++ H G+ YVP GS Sbjct: 74 LMYNSADEGFDGTYQTSVVVTHDGSCLYVPPGIFGS 109 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/58 (18%), Positives = 24/58 (41%) Frame = -3 Query: 256 RWAMISGEQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 R++ +K +KN ++ T + +E + PKI L+ ++ + N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNN 95 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/58 (18%), Positives = 24/58 (41%) Frame = -3 Query: 256 RWAMISGEQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 R++ +K +KN ++ T + +E + PKI L+ ++ + N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNN 95 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/58 (18%), Positives = 24/58 (41%) Frame = -3 Query: 256 RWAMISGEQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 R++ +K +KN ++ T + +E + PKI L+ ++ + N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNN 95 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/58 (18%), Positives = 24/58 (41%) Frame = -3 Query: 256 RWAMISGEQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 R++ +K +KN ++ T + +E + PKI L+ ++ + N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNN 95 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/58 (18%), Positives = 24/58 (41%) Frame = -3 Query: 256 RWAMISGEQKSEFKNSELKSRFSFTGIPKVIPTVLKESTNSPKIFILLTQISVREHTN 83 R++ +K +KN ++ T + +E + PKI L+ ++ + N Sbjct: 271 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNN 328 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +3 Query: 99 TDIWVSNMKIFGLLVLSFSTVGITFGIPVNENLDFNSEFLNSD 227 TD+WV +K F + + F T G + S+ L D Sbjct: 155 TDVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQTTSQNLEDD 197 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,869 Number of Sequences: 438 Number of extensions: 3809 Number of successful extensions: 23 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -