BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0207 (427 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39470.1 68418.m04780 F-box family protein ; similar to SKP... 26 9.3 At1g64790.1 68414.m07346 translational activator family protein ... 26 9.3 >At5g39470.1 68418.m04780 F-box family protein ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 170 Score = 26.2 bits (55), Expect = 9.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 232 MSPSDFCINLFGCLLLV*TLNFIKCWKIVYVSVVNII 122 +SPSD C +F C L ++ K W + Y VV ++ Sbjct: 111 LSPSDICDIIFCCKSLCALVDSEKTWLVQY-EVVKVV 146 >At1g64790.1 68414.m07346 translational activator family protein similar to HsGCN1 [Homo sapiens] GI:2282576 Length = 2440 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 150 IFQHFMKFNVYTNNRQPNKLIQKSLGDITFQKNF 251 IFQ ++ + + + LI K LG++TF K F Sbjct: 52 IFQTLAIYDDRASRKAVDDLIVKGLGNVTFMKTF 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,217,062 Number of Sequences: 28952 Number of extensions: 116094 Number of successful extensions: 164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -